SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000002432 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000002432
Domain Number 1 Region: 897-1032
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.16e-28
Family BCR-homology GTPase activation domain (BH-domain) 0.0023
Further Details:      
 
Domain Number 2 Region: 63-97
Classification Level Classification E-value
Superfamily WW domain 0.000000163
Family WW domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000002432   Gene: ENSCAFG00000001669   Transcript: ENSCAFT00000002618
Sequence length 1033
Comment pep:known_by_projection chromosome:CanFam3.1:13:37948788:37993305:-1 gene:ENSCAFG00000001669 transcript:ENSCAFT00000002618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQARDYDCESHDAAAQEPRLSGSSTRLEWVEIIEPRTRERMYANLVTGECVWDPPTGVR
IKRTSENQWWELFDPNTSRFYYYNATTQRTVWHRPQDCDIIPLAKLQTLKQNTESPRASA
ENSPGRGSSVSREGSTSSSLEPELDVSEKAQEPSGRASRQATFGALQEESGSSSPPGVFL
EKDYEIYRDYNVDGQLLHYRTSSLRWNSGTKERMLIKVADREPSFLASQGNGYALEGQAG
RTRRPSGGPHSPSLQQFAPEPDGPVFFPERRPSPFLKRAELGSCSPLLAQPRKAAGDSQP
SSPRYAYEPPLYEEPPVEYQAPIYDEPPMDVQYEAGAYPAGSPQRSPGRKPTAFPPSPKQ
GPASPYQQLVLTRQKCPERFLSLEYSPAGKEYVRQLVYVEQAGASPKLRAGPRPRFAASP
SGGSLPLQPGPCPLRGPRPGPPPGDYSSMEGAELRAAQDDAMSWSSQQDTMSSGGYSPGT
RKRKSRNPSLCHGPRERPGDHDVLGEQPPAEEPAPCGPRLGPGKGAEGKTAEAEPFLKAR
LPLEGQQAHFHIKPGGTWDSQQDGSGYESDGAVPLPMPGPVVRAFSEDEALAQQESKHWQ
RGALERLAFPQILLEKSVSVQTNLASPEPYLHPSQSEDLGSCAQFESSRQARSVMPSASC
VFPTFTLRKPSSETDIENWASKHFNTHTQGLFRRKVSIANMLAWSSESIKKPMIVTSDRH
VKKEACEIFKLIQMYMGDRRAKADPLHVALEIATKGWSVQGLRDELYIQLCRQTTENFRL
ESLARGWELMAICLAFFPPTPKFHSYLEGYIYRHMDPVNDTKVTQHMRALLERNSKKKPK
LRKKPKPYVEEPDGVAISTYAKYCYHKLQKAALTGAKKGLKKPNVEEIRHAKNAVFSPSM
FGSALQEVMSMQKERYPDRQLPWVQTRLSEEVLALNGDQTEGIFRVPGDIDEVNALKLQV
DQWKVPTGLEDPHVPASLLKLWYRELEEPLIPHEFYEQCIAHYESPEAAVAVVHALPRIN
RLVLCYLIRFLQV
Download sequence
Identical sequences E2RIB7
ENSCAFP00000002432 ENSCAFP00000002432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]