SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000002581 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000002581
Domain Number 1 Region: 30-141
Classification Level Classification E-value
Superfamily PH domain-like 8.5e-40
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000000765
Further Details:      
 
Domain Number 2 Region: 207-303
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 9.02e-35
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000639
Further Details:      
 
Domain Number 3 Region: 382-493
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 6.28e-25
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000002581   Gene: ENSCAFG00000001771   Transcript: ENSCAFT00000002784
Sequence length 505
Comment pep:known_by_projection chromosome:CanFam3.1:14:11828687:11901682:1 gene:ENSCAFG00000001771 transcript:ENSCAFT00000002784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGQQQPPPPRRVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKK
CSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALN
FANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQVN
NISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDLCG
ISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHSSGPP
PPPARGRGAPPPPPSRAPTAAPPPPPPSRPGVGVPPPPPNRMYPPPPPALPSSAPSGPPP
PPPPLSLTGSAAPPPPPPPPPPPGPPPPPGLPSDGDHQVPTPAGSKAALLDQIREGAQLK
KVEQNSRPVSCSGRDALLDQIRQGIQLKSVSDGQESTPPTPAPTSGIVGALMEVMQKRSK
AIHSSDEDEDEDDEEDFEDDDEWED
Download sequence
Identical sequences E2RCG1
ENSCAFP00000002581 ENSCAFP00000002581 XP_532445.2.84170 9615.ENSCAFP00000002581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]