SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000002772 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000002772
Domain Number 1 Region: 6-302
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.09e-61
Family BAR domain 0.000000279
Further Details:      
 
Domain Number 2 Region: 278-373
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-23
Family Pleckstrin-homology domain (PH domain) 0.0000132
Further Details:      
 
Domain Number 3 Region: 472-611
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-21
Family Phosphotyrosine-binding domain (PTB) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000002772   Gene: ENSCAFG00000001885   Transcript: ENSCAFT00000002989
Sequence length 662
Comment pep:known_by_projection chromosome:CanFam3.1:10:33192389:33242290:1 gene:ENSCAFG00000001885 transcript:ENSCAFT00000002989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAVDKLLLEEALQDSPQTRSLLSVFEEDAGTLTDYTNQLLQAMQRVYGAQNEMCLATQQ
LSKQLLAYEKQNFALGKGDEEVISTLHCFSKVVDELNVLHTELAKQLADTMVLPIIQFRE
KDLTEVSTLKDLFGLASNEHDLSMAKYSRLPKKKENEKAKTEVVKEVAAARRKQHLSSLQ
YYCALNALQYRKRVAMMEPMIGFAHGQINFFKKGAEMFSQSMNNFLSSVADMVQSIQGEL
EAEAEKMRVSQQELLSVDESIYAPDFDVAAPQINRNLIQKAGYLNLRNKTGLVTTTWERL
YFFTQGGNLMCQPRGAVAGGLIQDLDNCSVMAVDCEDRRYCFQITTPNGKSGIILQAESR
KENEEWICAINNISRQIYLTDNPEAVAIKLNQTALQAVTPITSFGKKHESSCPSQNLRNS
EMENDRIVPTAELRVPKADELIAPGTPIQFDIVLPATEFLEQNRGNRRINPFGETEDETF
PEAEDSLLQQMFIVRFLGSMAVKTDTTTEVIYEAMRQVLAARAIHNIFRMTESHLMVTSQ
TLRLIDPQTQVTRANFELTSVTQFAAHQENKRLVGFVVRTPESTGGEALSTYIFESNSEG
EKICYAINLGKEIIEVQKDPEALAQLMLSIPLTNDGKYVLLNDQPDDSDGSPSENRGAES
EA
Download sequence
Identical sequences E2RGZ8
XP_538418.2.84170 ENSCAFP00000002772 ENSCAFP00000002772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]