SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000002781 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000002781
Domain Number 1 Region: 460-624
Classification Level Classification E-value
Superfamily PH domain-like 4.65e-58
Family Phosphotyrosine-binding domain (PTB) 0.0000000466
Further Details:      
 
Domain Number 2 Region: 638-761
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-21
Family PDZ domain 0.0000304
Further Details:      
 
Domain Number 3 Region: 753-837
Classification Level Classification E-value
Superfamily PDZ domain-like 4.34e-16
Family PDZ domain 0.0000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000002781   Gene: ENSCAFG00000001897   Transcript: ENSCAFT00000002999
Sequence length 844
Comment pep:known_by_projection chromosome:CanFam3.1:1:87916298:87980056:1 gene:ENSCAFG00000001897 transcript:ENSCAFT00000002999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNHLEGSAEVEVPDEAAGGEVNESVEADLEHPEVEEEQQQEQQQQRHAGRPVRGRPVAAA
AEDPRAPPGPPEEEERGECLARSASTESGFHNHTDTAEGDVIAAARDGYDPERAQDPEDE
SAYAVQYRPEAEEYTEQAEAEHAEAAHRRALPNHLHFHSLEHEEAVNAAYSGYVYTHRLF
HRGEDEPYAEPYADYGGLQEHVYEEIGDAPELEARDGLRLLEQERAAAAAYRQEALGARL
HHYDERSDGESDSPEKEAEFAPYPRMDSYEQEEDIDQIVAEVKQSMSSQSLDKAAEDMPE
AEQDLERAPTPGPGGGRPDSPGQPQVPPAGQQRAAGPGGEAGQRYSKEKRDAISLAIKDI
KEAIEEVKTRTIRSPYTPDEPKEPIWVMRQDISPTRDCDDQRPVDGDSPSPGSSSPLGAE
SSSTPLHPSDPAEASSNKESRKSLASFPTYVEVPGPCDPEDLIDGIIFAANYLGSTQLLS
DKTPSKNVRMMQAQEAVSRIKMAQKLAKSRKKAPEGESQPMTEVDLFISTQRIKVLNADT
QETMMDHPLRTISYIADIGNIVVLMARRRMPRSNSQENVEASHPSQDGKRQYKMICHVFE
SEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDLLNTQDMYNDDLIHFSKSEN
CKDVFIEKQKGEILGVVIVESGWGSILPTVIIANMMHGGPAEKSGKLNIGDQIMSINGTS
LVGLPLSTCQSIIKGLKNQPRVKLNIVRCPPVTTVLIRRPDLRYQLGFSVQNGIICSLMR
GGIAERGGVRVGHRIIEINGQSVVATPHEKIVHILSNAVGEIHMKTMPAAMYRLLTAQEQ
PVYI
Download sequence
Identical sequences E2RG74
ENSCAFP00000002781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]