SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000002783 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000002783
Domain Number 1 Region: 481-645
Classification Level Classification E-value
Superfamily PH domain-like 4.78e-58
Family Phosphotyrosine-binding domain (PTB) 0.0000000466
Further Details:      
 
Domain Number 2 Region: 659-782
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-21
Family PDZ domain 0.0000304
Further Details:      
 
Domain Number 3 Region: 774-858
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-16
Family PDZ domain 0.0000181
Further Details:      
 
Domain Number 4 Region: 38-74
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000915
Family beta-sandwich domain of Sec23/24 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000002783   Gene: ENSCAFG00000001897   Transcript: ENSCAFT00000003001
Sequence length 865
Comment pep:known_by_projection chromosome:CanFam3.1:1:87916227:87980784:1 gene:ENSCAFG00000001897 transcript:ENSCAFT00000003001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNHLEGSAEVEVPDEAAGGEVNESVEADLEHPEVEEEQQQEQQQQQQEQQQQQQQHPPPP
QQQQQQRHAGRPVRGRPVAAAAEDPRAPPGPPEEEERGECLARSASTESGFHNHTDTAEG
DVIAAARDGYDPERAQDPEDESAYAVQYRPEAEEYTEQAEAEHAEAAHRRALPNHLHFHS
LEHEEAVNAAYSGYVYTHRLFHRGEDEPYAEPYADYGGLQEHVYEEIGDAPELEARDGLR
LLEQERAAAAAYRQEALGARLHHYDERSDGESDSPEKEAEFAPYPRMDSYEQEEDIDQIV
AEVKQSMSSQSLDKAAEDMPEAEQDLERAPTPGPGGGRPDSPGQPQVPPAGQQRAAGPGG
EAGQRYSKEKRDAISLAIKDIKEAIEEVKTRTIRSPYTPDEPKEPIWVMRQDISPTRDCD
DQRPVDGDSPSPGSSSPLGAESSSTPLHPSDPAEASSNKESRKSLASFPTYVEVPGPCDP
EDLIDGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAVSRIKMAQKLAKSRKKAPEGESQ
PMTEVDLFISTQRIKVLNADTQETMMDHPLRTISYIADIGNIVVLMARRRMPRSNSQENV
EASHPSQDGKRQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKEYS
DLLNTQDMYNDDLIHFSKSENCKDVFIEKQKGEILGVVIVESGWGSILPTVIIANMMHGG
PAEKSGKLNIGDQIMSINGTSLVGLPLSTCQSIIKGLKNQPRVKLNIVRCPPVTTVLIRR
PDLRYQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATPHEKIVHILSNAV
GEIHMKTMPAAMYRLLTAQEQPVYI
Download sequence
Identical sequences E2RG71
ENSCAFP00000002783 ENSCAFP00000002781 XP_005615936.1.84170 XP_013973125.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]