SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000002920 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000002920
Domain Number 1 Region: 229-415
Classification Level Classification E-value
Superfamily RNI-like 2.45e-24
Family 28-residue LRR 0.094
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000002920
Domain Number - Region: 123-159
Classification Level Classification E-value
Superfamily F-box domain 0.000916
Family F-box domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000002920   Gene: ENSCAFG00000001987   Transcript: ENSCAFT00000003144
Sequence length 434
Comment pep:known_by_projection chromosome:CanFam3.1:12:12687892:12704673:-1 gene:ENSCAFG00000001987 transcript:ENSCAFT00000003144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQETLVTPTLSVLSRSSITMQDRSSTAGQASSTGPQPSRPSVIPPPSKSKGWKSGANVRR
MRRIIAEDPEWSLAIVPLLTELCIQHIVENFQNNPILKQLLPEHQQKVLNHLSPDLPLTV
TANLIDDENYWRRCCMQRWPVCHVARHGGSWKRLFFERHLENLIKHFIPSTTDPAVILDL
LPFCRNYVRRLRVDQFLPPVQLPLQPWNGELSDSGSEAEMEQPTGDHYQLRDLVAGLSHL
EELDLVYGVKDCGMNFEWNLFLFTYQDCHSLAATIKACHTLKTFRLTRSKVDDDKARILI
RSLLDHPALEELDLSHNLIGDRGARAAAKLLSHSHLRVLTLANNQVLTVNTTLTSINLSC
NHIGLDGGKQLLEGMSDNKTLLEFDLRLSDVAQESEYLIGQALCANREAARQRALNPSHF
MSPITAKGPENPVG
Download sequence
Identical sequences E2RLR4
ENSCAFP00000002920 ENSCAFP00000002920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]