SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000002935 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000002935
Domain Number 1 Region: 2894-3047
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.01e-62
Family Cyclophilin (peptidylprolyl isomerase) 0.0000014
Further Details:      
 
Domain Number 2 Region: 1114-1246
Classification Level Classification E-value
Superfamily PH domain-like 9.96e-48
Family Ran-binding domain 0.000000294
Further Details:      
 
Domain Number 3 Region: 2201-2331
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-45
Family Ran-binding domain 0.0000443
Further Details:      
 
Domain Number 4 Region: 1903-2034
Classification Level Classification E-value
Superfamily PH domain-like 8.46e-44
Family Ran-binding domain 0.00000107
Further Details:      
 
Domain Number 5 Region: 2797-2899
Classification Level Classification E-value
Superfamily PH domain-like 3.32e-34
Family Ran-binding domain 0.00011
Further Details:      
 
Domain Number 6 Region: 31-192
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000632
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 
Domain Number 7 Region: 1610-1636
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000373
Family Ran binding protein zinc finger-like 0.002
Further Details:      
 
Domain Number 8 Region: 1358-1385
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000563
Family Ran binding protein zinc finger-like 0.0019
Further Details:      
 
Domain Number 9 Region: 1486-1512
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000942
Family Ran binding protein zinc finger-like 0.002
Further Details:      
 
Domain Number 10 Region: 1670-1698
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000108
Family Ran binding protein zinc finger-like 0.0017
Further Details:      
 
Domain Number 11 Region: 1550-1576
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000157
Family Ran binding protein zinc finger-like 0.0019
Further Details:      
 
Domain Number 12 Region: 1423-1449
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000157
Family Ran binding protein zinc finger-like 0.002
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000002935
Domain Number - Region: 1297-1323
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00337
Family Ran binding protein zinc finger-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000002935   Gene: ENSCAFG00000023061   Transcript: ENSCAFT00000003160
Sequence length 3047
Comment pep:known_by_projection chromosome:CanFam3.1:10:35086853:35181646:-1 gene:ENSCAFG00000023061 transcript:ENSCAFT00000003160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRSKADVERYIASVQGSVPSPREKSMKGFYFAKLYYEVKEYDLAKKYISAYINVQERDP
KAHRFLGLLHEAEENIDKAVECYKRSVELNPTQKDLVLKIAELLCKNDVTDGRAKYWVER
AAKLFPGSPAIYKLKEQLLDCKGEDGWNKLLDLIQSELYARPDDVYVNIRLVELYRSNNR
LKDAVGHCHKAEKNIALRSSLEWNSCVVQTLKEYLESLQCLESDKSNWQTTNKDLLLAYA
NLMFLTLSTRDVQESRELLESFDSALQSVKSCVGGNDELSATFLEVKGHFYMHAGSLLLK
MGQHSEVQWRALSELATLCYLIAFQVPRPKIKLIKGEVGQNLVEMMAYDRLSQSGHMLLN
LSRDKQDFLKEVVESFANKSGQSALYDALFSSQSLKDRSFLGNDDIGNIDVQAPEPDDLA
RYDVGAIRAHNGNLQHLTWLGLQWNSLSALPAVRKWLKQLFHHLPQETSRLETNAPESIC
ILDLEVFLLGVIYTSHLQLKEKCSSHYSFYQPLCLPLPVCKQLCTERQKSWWDAVCNLIH
RKTVPGTTAKLRLLVQHDINTLRGQEKHGLQPALLVHWAKCLQKTGSGLNSFYDQREYIG
RSVHYWKKVLPMLKTIKKKSSIPEPTDPLFKHFHSADIQASEVGEYEEEAHITFAILDVV
NGNIEDAMTAFESVKNVVSYWNLALIFHRKAEDIENDTLSPEEQEECKNYLRKARDYLIK
ILDDSDSNLSVAKKLPVPLESVKEMLNSVMQELDDYSEGGALYKNGSLRNADSEIKHSTP
SPSIYSLSPSKSYKFSPKTPPRWAEDQNSLLKMICQQVEAIKKEMQELKLHSSNSGSPHR
WPAENYGPDSVPDGYQGSQTFHGAPLTVATTGPSVYYSQSPAYNSQYLLRPAANVTPTKG
PVYGMNRLPPQQHIYAYSQQMHTPPVQSSSACMFSQEMYGPPLRFESPATGILSPRGDDY
FNYNVQQTSTNPPLPEPGYFTKPPVAAHASRSAESKVVTQPPSTAYNSNESLLGLLTSDK
PLQGDGYSGSKASQTVGPRNMFSFGSKNVPGLSFTENMGPNQQKNSGFRRSDDMFTFHGP
GKSVFGTPAPELANKSHETDGGSAHGDDDDDGPHFEPVVPLPDKIEVKTGEEDEEEFFCN
RAKLFRFDVESKEWKERGIGNVKILRHKTSGKIRLLMRREQVLKICANHYISPDMKLTPN
AGSDRSFVWHALDYADELPKPEQLAIRFKTPEEAALFKCKFEEAQSILKALGANVATTTN
QAMRIVKEPMSHDNKDICKSDAGNMNFEFQIAKKEGSWWYCNSCSLKNAATAKKCVSCQN
LNPNKKELLGPPLVETVSALKTDPENTSDRFASMTPKKEGHWDCSICLVRNEPTVSRCIA
CQNAKAANKSGSSFVQQASFKFGQGDLPKSVNSDFRSVFSAKEAQWDCSVCLVQNDGSSA
KCAACQNPRKQSLPTSSVSAPPSFKFGTSEIGKTPKSGFEDMFAKKEGQWDCSICLVRNE
ANATICVACQNPGKPSLSTSSVPAPASFKFSTSETSKAPKSGFEGMFTKKEGQWDCSICL
VRNEASATTCVACQNPSKQNQPPSAVVAPAASSDTCKAPKSGFEGMFTKKEGQWDCGICL
VRNEASATTCVACQNPSKQNQPASAGLAPAASSDTCKAPKSGFEGMFTKKEGQWDCGICS
VQNESSSLKCVACHASKPTHKPVAEAPSAFALGSKTKLSDSSGSQIGTGFKSNFSEKAFK
FGTTEQGFKFGHVDQESTPSFTFQGSSSTDSKSTKEGFSFSVPMSADGFKFGIQEPGNQE
KKSEKPLENDTGVQAQDISGQKNDSGVIFGQTGSTFTFADLAKSTSGEGFQFGKKDPNFK
GFSGAGEKLFSSQSGKMADKADTSADLEKDDDAYRTEDSDDIHFEPVVQMPEKVELVTGE
EDEKVLYSQRVKLFRFDAEISQWKERGLGNLKILKNEVNGKLRMLMRREQVLKVCANHWI
TTTMNLKPLSGSDRAWMWLASDFSDGDAKLEQLAAKFKTPELAEEFKQKFEECQRLLLDI
PLQTPHKLVDTGRAAKLIQRAEEMKSGLKDFKTFLTNDQTKVTDGESESSDAGSANASDT
ISKPNPENTGPTLEWDNYDLREDALDDSVSSSSVHASPLASSPVRKNLFRFGESTTGFNF
SFKSALSPSKSPAKLNQSGTSVGTDEESDVTQEEERDGQYFEPVVPLPDLVEVSSGEENE
QVVFSHRAKLYRYDKDVGQWKERGIGDIKILQNYDNKQVRIVMRRDQVLKLCANHRITPD
MTLQNMKGTERVWVWTACDFADGERKVEHLAVRFKLQDVADSFKKIFDEAKIAQEKDSLI
TPHVSRSTTPRESPCGKIAVAVLEETTRERTDLTQDDNTADATSEVGEVSSTSEATTKAV
VSPPKFVFGSESVKSIFSSEKSKPFAFGHSSATGSLFGFSFNAPLKNNSSEVSSVVKSGS
ERRVEPNGEESKNSDSKQSSDGKVRNLFAFPKEESSTNYTFKTPEKAKEKEKPEDPSSDD
DVFIVYELTPTPEQKALASKLKLPPTFFCYKNKPDYVSEEEDDEDFETAVKKLNGKLYLD
DSEKCRPLEEKLTDNEKECVIVWEKKPTVEEKAKADTLKLPPTFFCGVCSDTDEDNGNGE
DFQSEFQKVQDSQKSQNEEVTSTADSVYTGGTKVTVPFLCKSEETDFIAKSISSSPISSG
TVDKPVDLSTRKENDGDSTSQVESKTVSFGFGSSTGLSFADLASSNSGDFAFGSKDKNFQ
WANTGAAVFGTQSSSKVGEDEDDSDEEVVHNEDIHFEPIVSLPEVEVKSGEEDEEILFKE
RAKLYRWDRDVSQWKERGVGDIKILWHTLKNYYRILMRRDQVFKVCANHVITKTMELKPL
NVSNNALVWTASDYADDEPLGRITMELFSNIVPLTAENFRALCTGEKGFGFKNSIFHRVI
PDYVCQGGDITKHDGTGGRSIYGDKFEDENFDVKHTGPGLLSMANRGRDTNNSQFFITLK
KAEHLDFKHVVFGFVKDGMDTVKKIESFGSPKGSVSRRISITECGQI
Download sequence
Identical sequences F1PA81
ENSCAFP00000002935 ENSCAFP00000002935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]