SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000003022 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000003022
Domain Number 1 Region: 1433-1502
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000945
Family SH3-domain 0.0025
Further Details:      
 
Domain Number 2 Region: 996-1170
Classification Level Classification E-value
Superfamily RUN domain-like 0.00000000562
Family RUN domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000003022   Gene: ENSCAFG00000002049   Transcript: ENSCAFT00000003251
Sequence length 1512
Comment pep:known_by_projection chromosome:CanFam3.1:11:52074166:52144356:1 gene:ENSCAFG00000002049 transcript:ENSCAFT00000003251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLFEISRMDSPPKLTGETLIVHHIPLVHCQVPDRQCCGGASGGSGSTRPNPFCPPDLGI
TQPDQDLGQADSLLFNSLHSAPGGSTRPADSTKSRVRDGRGPGAPKRHNPFLLQESVAEP
GLGNLYDDSIVDSATQQSFHLHGAGQPTFHLSPFQLPPPGPRVGRPWGATRSRAGVVEGQ
EQEPVATVDPQHCSTSHCCRPDLEAETMELDECGGPGGSGSGGGASDTSGFSFDQEWKLS
SDESPRNPGCSGSGPQHCRCSSTSSQSEAADQSMGYVSDSSCNSSDGVLVTFSTLYNKMH
GNSRANLNSAPQSCSNSSFCSHSDPGAFYLDLQPSPAESKMSCESHHPDSGGREGSYGCP
HASSPELDANCNSYRPHCEPCPAVADLTACFQSQARLVVATQNYYKLVTCDLSSQSSPSP
AGSSITSCSEEHTKISPAPGPGPDPGPSQPSEYYLFQRPEVQPEEQGAVGSSVEAATPVG
PTVIEGQVYTNTSPPNLSTGRQRSRSCDRSLARSPPVRLGSLERMLSCPVRLSEGPAALA
GTGSPPRRVTSFAELAKGRKKVAGSGSPPLRVSIGDSSQEFSPIQEAQQDRVGPLDEGTR
CSHSLPPMPLGPGMDLVGPESWSTQVCQGPQSSEVPPASLRAAGQGPLAQLMDPGPALPG
SPANSHTQKDTRARADGGGAESRPVLRYSKEQRPTTLPIQPFVFQHHFPKQLAKARALHS
LSQLYSLSGCSRAQQPASLAASTAQAPTLASSGESQAPTNRGARKAGPEPETSRPSPLGS
YSPIRSAGPFGPSTDSSASTSCSPPPEQATATESPPPWSHSCPPVARPATSQQPQKEDQK
ILTLAEYRLHGTGSLPPLGSWRSSLSRAESLARGGGEGSMASRPNNANHLSPQALKWREY
RRKNPLGPPGLSGSLDRRPQEARLARRNPIFEFPGSFSAAGHLNYRLNGQIVKPLPLTCP
DFQDPFSLTEKPPAEFCLSPDGNSEAISIDLLQKKGLVKAVNTAVDLIVAHFGTSRDPGV
KAKLGNSSVSPNVGHLVLKYLCPAVQAVLEDGLKAFVLDVIIGQRKNMPWSVVEASTQLG
PSTKVLHGLYNKVSQFPELTSHTMRFNAFILGLLNIRSLEFWFNHLYNHEDIIQTHYQPW
GFLSAAHTVCPGLFEELLLLLQPLALLPFSLDLLFQHRLLQSGQQQRQHKELLRVSQDLL
LSAHSTLQLARARGQEGPGDVDRAVHGERVKGVGAPEGGEDEEEDETEEVAEAAGGSGRG
RWARGGQAGWWYQLMQSSQVYIDGSTEGSRFPRGGTSSSIEKKKGAGGGGPPPREGVVEG
AEACPAPEETLGRDRGWPFWMGSPPDSVLAELRRSREREGSTAPPAENEEGASEPSPGGI
KWGHLFGSRKAQRETRPTNRLPSDWLSLDKSMFQLVAQTVGARRDPEPKESLQDPHSPVL
PSKPPCEVKALCHHLATGPGQLSFHKGDILRVLGPAGGDWLRCSRGPDTGLVPLAYVTLT
PTPSPTPGSSQN
Download sequence
Identical sequences E2RAL6
9615.ENSCAFP00000003022 ENSCAFP00000003022 XP_005626832.1.84170 XP_005626833.1.84170 XP_005626834.1.84170 XP_538715.3.84170 ENSCAFP00000003022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]