SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000003053 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000003053
Domain Number 1 Region: 10-218
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.07e-41
Family DBL homology domain (DH-domain) 0.00048
Further Details:      
 
Domain Number 2 Region: 207-338
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-17
Family Pleckstrin-homology domain (PH domain) 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000003053   Gene: ENSCAFG00000002073   Transcript: ENSCAFT00000003287
Sequence length 339
Comment pep:known_by_projection chromosome:CanFam3.1:11:52197462:52200738:-1 gene:ENSCAFG00000002073 transcript:ENSCAFT00000003287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METSGAGGRCPVQEQRARWERKRTCTARELLQTERRYQEQLGLVATYFVGILRAKGTLRA
AERHALFGPWELIYGASHHPRRDLLPYLEGGHWGQGLESFCPHLELYTQFAANAEKSRTT
LQEQLKKNKRFRRFVRLQEGRPEFGSLRLQDLLPLPLQRLQQYENLVMALAENTVPSSPD
HQQLTRAARLISETAQRVHSIGQRQRNDQHLRRIQALLSGRQAKGLTSGRWFLRQGWLLV
VPPRGEPRPRMFFLFSDVLLMAKPRPPLHLLQSGTFACRALYPMAQCQLHRVFGHSGGPC
GGLLSLSFPHEKLLLMCTDQEELLHWHHSLTLAISSQKN
Download sequence
Identical sequences F1PUW0
ENSCAFP00000003053 ENSCAFP00000003053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]