SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000003204 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000003204
Domain Number 1 Region: 1-142
Classification Level Classification E-value
Superfamily PH domain-like 5.09e-46
Family Phosphotyrosine-binding domain (PTB) 0.000000767
Further Details:      
 
Domain Number 2 Region: 307-417
Classification Level Classification E-value
Superfamily SH2 domain 2.42e-28
Family SH2 domain 0.0000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000003204   Gene: ENSCAFG00000002201   Transcript: ENSCAFT00000003456
Sequence length 425
Comment pep:known_by_projection chromosome:CanFam3.1:1:97019997:97094805:1 gene:ENSCAFG00000002201 transcript:ENSCAFT00000003456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSLDFSTRTQITREAISRVCEAVPGTKGAFRKRKPPSKMLSSILGKSNLQFAGMSISLT
ISTASLNLRTPDSKQIIANHHMQSISFASGGDPDTTDYVAYVAKDPVNRRACHILECCDG
LAQDVIGSIGQAFELRFKQYLQCPSKVPAFHDRMQSLDEPWTEEEGDGSDHPYYNSIPSK
TPPPGGFVDVRLHARPHAPDTAQFAGKEQTYYQGRHLGDPFGEDWQQTPVRQGSLDIYST
PEARVPAAPGEAPTYVNAQHIPVQATPASGSSTESSPLKDLFDMKPFEDALRNQSLGPVL
SKAASVECISPVTPRAPDAKMLEELEGEPWYQGEMSRKEAEGLLKNDGDFLVRKSATNPG
SFVLTGMHNGQAKHLLLVDPEGTIRTKDRVFDSISHLINHHLENSLPIVSAGSELCLQQP
VEKTL
Download sequence
Identical sequences F1PPW0
ENSCAFP00000003204 ENSCAFP00000003204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]