SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000003225 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000003225
Domain Number 1 Region: 87-272,380-422
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.14e-21
Family WD40-repeat 0.0051
Further Details:      
 
Domain Number 2 Region: 10-87
Classification Level Classification E-value
Superfamily F-box domain 3.79e-16
Family F-box domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000003225   Gene: ENSCAFG00000002216   Transcript: ENSCAFT00000003479
Sequence length 470
Comment pep:known chromosome:CanFam3.1:1:97630991:97662228:1 gene:ENSCAFG00000002216 transcript:ENSCAFT00000003479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPQLGLHELLHVFSFLEARDLLRAAQVDKVWNEVSRTKELWRQLCLRRWSSYKAPQMTL
GTQTWKEYYLCRSELEFRMESGRPEKDFICKAIAGHNGGIDELAYISTNECRFDGQEKSV
VCTVSSDSTVRAWDVQEGTEIWSSPLQPAALVNLAAYPRLQLVVTVDKQGLIKTWKAENG
REWASFSLPTSSSALQACDHPETPFLLVASAEGVMYTLTVPQLQLLSWTSVFPSSPTSLL
CSPDSQWVFASTQDSDLGPKVFYTQSLRCVVEDEPPVSSTLPVLLTSRACWAPDETARLM
VMHRNSDNMRLAITTYELGTKQSQKGVDAVEKVQQIASFLLPDNMMPPHLMKGHGSQVVL
LVSGLELVLFTIQGLQLAAFQDHQKPITSMWVDQSRVLTASFDLSLRVYVWNKENKFPVL
KSCYHLLGGSHRWASGFTHVESDSMSIVGIEARSIGTSILRSYCFNVQHG
Download sequence
Identical sequences F1PPV6
ENSCAFP00000003225 ENSCAFP00000003225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]