SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000003297 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000003297
Domain Number 1 Region: 286-364
Classification Level Classification E-value
Superfamily F-box domain 1.3e-17
Family F-box domain 0.0029
Further Details:      
 
Domain Number 2 Region: 193-224
Classification Level Classification E-value
Superfamily MIT domain 0.0000405
Family MIT domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000003297   Gene: ENSCAFG00000002264   Transcript: ENSCAFT00000003559
Sequence length 548
Comment pep:known_by_projection chromosome:CanFam3.1:12:20514432:20562507:1 gene:ENSCAFG00000002264 transcript:ENSCAFT00000003559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGSSAAASGVSSSADAVLARSSASAGSGRPSAPRLPGRRSSAPGSGPLPREDGCRTPGPQ
LLPLPGALLRPRTLLSPAATGRSRHPDAQRTSSGERRGGGAESPSPAAGCPASMAEAEED
CHSDTVRAEDDENESPAETDLQAQLQMFRAQWMFELAPGVGSSNLETRPCRAAKGSLLKA
ADTKGKQELAKEEKARELFLKAVEEEQNGALYEAIKFYRRAMQLVPDIEFKITYTRSPDG
DGVGNSYMEDNDDDSKMADLLSCFQQQLTFQESMLKLCQPELENNQTHISVLPMEVLMYI
FRWVVSSDLDLRSLEQLSQVCRGFYICARDPEIWRLACLKVWGRSCIKLVPYTSWREMFL
ERPRVRFDGVYISKTTYIRQGEQSLDGFYRAWHQVEYYRYIRFFPDGHVMVLTTPEEPQS
IVPRLRTRNTRTDAILLGHYRLSQDTDNQTKVFAVITKKKEEKPLDYKYRYFRRVPVQEA
DQSFHVGLQLCSSGHQRFNKLIWIHHSCHVTYKSTGETAVTAFEIDKMYTPLFFARVRSY
TAFSERPL
Download sequence
Identical sequences F1PP23
9615.ENSCAFP00000003297 ENSCAFP00000003297 ENSCAFP00000003297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]