SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000003318 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000003318
Domain Number 1 Region: 160-367
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.4e-57
Family DBL homology domain (DH-domain) 0.00019
Further Details:      
 
Domain Number 2 Region: 350-496
Classification Level Classification E-value
Superfamily PH domain-like 1.62e-32
Family Pleckstrin-homology domain (PH domain) 0.002
Further Details:      
 
Domain Number 3 Region: 461-502,540-596
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.28e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0059
Further Details:      
 
Domain Number 4 Region: 628-726
Classification Level Classification E-value
Superfamily PH domain-like 1.71e-16
Family Pleckstrin-homology domain (PH domain) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000003318   Gene: ENSCAFG00000002283   Transcript: ENSCAFT00000003583
Sequence length 746
Comment pep:known_by_projection chromosome:CanFam3.1:1:98624895:98647969:-1 gene:ENSCAFG00000002283 transcript:ENSCAFT00000003583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESEGTSSTTHAPGAVLGEPDAGPGCASLELPRADPGKLQGLPLGPRAHGKDPDLGSPGT
PTTSGDGPLDLGPSGGPNGGAKLPNRDSGIDSPSCSVVSEQFPCEEGGEASRGPAVLGHL
EAAPEGEAVREAADSNVGEGNGEEPDPKSSPLRAPVDPVKCPKSQKLLHIAQELLHTEET
YVKRLHLLDQVFCAQLVEAGIPSEVTTGIFSNISSIYRFHGHFLLPELQTRITQEWDTNP
RLGDILQKLAPFLKMYGEYVKNFDRAVELVSTWTQRSPLFKDIVQSIQKQDVCGNLTLQH
HMLEPVQRVPRYELLLKDYLKRLPRDAPDWKDAERSLELISTAANHSNAAIRKMEKMHKL
LEVYERLGGEEDIVNPANELIKEGPIQKLSAKSGSAQDRHLFLFNSMILYCVPKLRLMGQ
KFSVREKMDISGLQVQDIVKSNAAHTFIIKGRKRSLELQTRTEEEKKEWIQVIEDTIERH
KQNSQTFKAFSSSFGQDEDPSLPPNPSVVSASPEEPALAASGGGGVAGLESRRGSAKTGR
DKEKLGCRSCGEAFNSITKRKHRCKLCGVVICGKCSEFKAENGRQSRVCRGCFLTQRAVP
ESPSPEVAPEEPKHSTEGPAAVDPQPSLLCGHLQVSDSGAAWSEVWATIPASDPLELVLH
LQEDSQDGWPPRTVPLSGCTVSVLDPAEMPDSRHVWRLQRGQQSLYLSTPSVDLQKRWLE
ALSAAARGDPGLAALSAPSPSSVAWP
Download sequence
Identical sequences E2RPK4
9615.ENSCAFP00000003318 ENSCAFP00000003318 ENSCAFP00000003318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]