SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000003387 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000003387
Domain Number 1 Region: 5-198,397-649
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 6.57e-138
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000000859
Further Details:      
 
Domain Number 2 Region: 199-397
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 3.66e-48
Family ValRS/IleRS/LeuRS editing domain 0.0000288
Further Details:      
 
Domain Number 3 Region: 655-909
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 6.73e-44
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000003387   Gene: ENSCAFG00000002340   Transcript: ENSCAFT00000003663
Sequence length 1262
Comment pep:known_by_projection chromosome:CanFam3.1:1:99050994:99113524:1 gene:ENSCAFG00000002340 transcript:ENSCAFT00000003663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQQVPENINFPAEEEKILQFWSEFNCFQECLTQSKHKPKFTFYDGPPFATGLPHYGHIL
AGTIKDIVTRYAHQSGFHVDRRFGWDCHGLPVEYEIDKTLGIRGPEDVAKMGIVEYNNQC
RAIVMRYSTEWKSTVTRLGRWIDFDNDYKTLYPQFMESVWWVFKQLYDKGLVYRGVKVMP
FSTACNTPLSNFESHQNYKDVQDPSVFITFPLEEDENVSLVAWTTTPWTLPSNLALCVNP
EMQYVKIKDVTRGKLLILMEARLLALYKVETDYEILERFPGSYLKGKKYRPLFDYFVQLK
ENGAFTVLADSYVREEEGTGVVHQAPYFGADDYRVCMDFNIIQKDSPPVCPVDASGCFTA
EVTDFMGQYVKDADKNIIRTLKERGRLLIASTLTHSYPFCWRSDTPLIYKAVPSWFVRVE
HMVDQLLQNNDLCYWVPEFVREKRFGNWLKDARDWAVSRNRYWGTPIPLWVSDDFEEVVC
IGSVAELEELTGAKVSDLHRESIDHLTIPSHCGKGVLRRISEVFDCWFESGSMPYAQVHY
PFENKREFDDAFPADFIAEGIDQTRGWFYTLLVLATALFGQPPFRNVIVNGLVLASDGQK
MSKRKKNYPDPLSIIHKYGADALRLYLINSPVVRAENLRFKEEGVRDVLKDVLLPWYNAY
RFFIQNVLRLQKEEEMEFIYNENTARESANVTDRWVLSCMQSLVGFFETEMAAYRLYTVV
PRLVKFVDVLTNWYVRMNRRRLKGENGVEDCVTALETLFSVLLSLCRLMAPYTPFLTELM
YQNLKLLIDPVSVQDKDTQSIHYLMLPHVREELIDKSTESAVSRMQSVIELGRVIRDRRT
IPIKYPLKEIVVIHQDPEALHEIRSLEKYIIEELNVREVTLSTDKNKYGIRLRAEPDHMV
LGKRLKGAFRAVMAAIKQLSSEELECFQESGTIVVEGHELHEEDIRLMYTFDQKTGGTTQ
YEAHSDAQALVLLDVTPDQSMVDEGVAREVINRIQKLRKKCNLVPTDEITVYYKAKSEGK
YLNNVIESHMEFIFATIKAPLKPYPVPVSDKIIIQEEMQLKGSALEITLTRGSSLPGPVC
AYVNLNIYANGSEQGGVLLLENPKGDNRLDVLKLKSIITSIFGVRNSELAVLHGAVEIQN
QTDLLSISGKTLRVAAGSAPAVVDGPSTALCRYINLQLLNAGPQECVKGTVGTLLLENPP
GQNGLTHQGLLYEAAKVFGLRSRKLKLFLNETQTHEITEEIPMKALNMKTVYVSVLPTTA
DF
Download sequence
Identical sequences F1PLJ9
ENSCAFP00000003387 ENSCAFP00000003387 XP_013973605.1.84170 XP_541332.3.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]