SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000003455 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000003455
Domain Number 1 Region: 510-673
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.41e-17
Family Virulence factor P.69 pertactin 0.051
Further Details:      
 
Domain Number 2 Region: 6-80
Classification Level Classification E-value
Superfamily F-box domain 1.7e-16
Family F-box domain 0.0035
Further Details:      
 
Domain Number 3 Region: 723-882
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000000196
Family Pectate transeliminase 0.065
Further Details:      
 
Domain Number 4 Region: 108-255
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000222
Family Pectate lyase-like 0.056
Further Details:      
 
Domain Number 5 Region: 427-511
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000432
Family Pectate transeliminase 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000003455   Gene: ENSCAFG00000002382   Transcript: ENSCAFT00000003736
Sequence length 955
Comment pep:known_by_projection chromosome:CanFam3.1:11:53835003:53858939:-1 gene:ENSCAFG00000002382 transcript:ENSCAFT00000003736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAGGLPLELWRMILAYLHLPDLGRCSLVCRAWYELILSLDSTRWRQLCLECTECRHPNW
PNQPDVEPESWREAFKQHYLASKTWTKNALDLESSVCFSLFRRRRERRTLSVGPGHEFDS
LGSALAMASLYDRIELFPGVYEEQGEIILKVPVEIVGHGKLGEVALLASIDQHCSTTRLC
NLVFMPAWFSPFMFKTTSGHIQFDNCNFENGHIQVHGPGTCQVKFCTFKNTHVFLHNVPL
CVLENCEFVGSENNSVTVEGHPSADKNWAYKYLLGLIKSSPSMLPTEDSDSLMSLDLESR
DQAWSPRTCDIVIEGSQSPTSPAATSPKPGSKAGSQEAEVGSDGERVAQTPDSSDGGLSP
SGEDEDEDQLTYRLSYQVQGPRPVLGGSFLGPPLPGASIQLPSCLVLNSLQQELQKDKEA
MGLASSVQGCLIRKCLFRDGKGGVFVCSYGRAKMEGNIFRNLTYAVRCIHNSKIVMLRND
IHRCRASGIFLRLEGGGLIAGNNIYHNAEAGIDIRKKSNPLILCNQIHHGLRSGIVVLGN
GKGIIRNNQIFSNKEAGIYILYHGNPVVSGNHIFKGRAAGIAVNENGKGLITENVIRENQ
WGGVDIRRGGVPVLRSNLICFGYSDGVVVGDEGKGLIEGNTIYANKGCGVWMMSSSLPHV
TSNHVSYNGLYGVAVFSQKDGSGEFPGGHGAQENFSEDGDAILWEPELEKDDDPLRRPVT
IALVESNSINHNGASGLYVQSSEALHVVTNVIHANGDRGITVAQSGQLTRVTNNSISCNR
QSGVKVEAQCKVELRGNGIYDNRGGIFTKGGSTRGTENDIIGNRGSGLQLLSSSETSVIK
NRIHSFRAYGIAVRGRAKALVQENIIFQGKTSKTIFQQISNNRECILQNNKFLVFKKKSD
TWRLVNPPARPHLESSLRGPSAAHSGQKVTAMATRITARVEGGYHSNRSVFCTIL
Download sequence
Identical sequences F1PJ43
ENSCAFP00000003455 ENSCAFP00000003455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]