SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000003477 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000003477
Domain Number 1 Region: 386-505
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-25
Family SH2 domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000003477   Gene: ENSCAFG00000002397   Transcript: ENSCAFT00000003759
Sequence length 510
Comment pep:novel chromosome:CanFam3.1:11:54190231:54328747:-1 gene:ENSCAFG00000002397 transcript:ENSCAFT00000003759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKWLHIRGSLGNSKTKSPPQPPRPDYREQRRRGERPSQAPQAVPQAPAGASASCGPTAA
SCFSTSSGSLPDDSGSTSDLIRAYRAQKERDFEDPYNGPGSSLRKLRAMCRLDYCGGGGE
PGGGQRAFSASSASGAAGCCCASSGAGAAASSSSSSGSPHLYRSSSERRPATPAEVRYIS
PKHRLIKVESAAGGAGDLPGGACSGGRTWSPTACGGKKLLNKCAASAAEESGAGKKDKVT
IADDYSDPFDAKNDLKSKAGKGESAGYMEPYEAQRIMTEFQRQESVRSQHKGIQLYDTPY
EPEGQSVDSDSESTVSPRLRESKLPQDDDRPADEYDQPWEWNRVTIPALAAQFNGNEKRQ
SSPSPSRDRRRQLRAPGGGFKPIKHGSPEFCGILGERVDPAVPPTGSRIYWYHGAISRGD
AENLLRLCKECSYLVRNSQTSKHDYSLSLKSNQGFMHMKLAKTKEKYVLGQNSPPFDSVP
EVIHYYTTRKLPIKGAEHLSLLYPVAVRTL
Download sequence
Identical sequences E2RHS8
ENSCAFP00000003477 ENSCAFP00000036235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]