SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000003798 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000003798
Domain Number 1 Region: 19-131
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.96e-43
Family Pyk2-associated protein beta ARF-GAP domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000003798   Gene: ENSCAFG00000002612   Transcript: ENSCAFT00000004108
Sequence length 446
Comment pep:known chromosome:CanFam3.1:12:33142621:33320398:1 gene:ENSCAFG00000002612 transcript:ENSCAFT00000004108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGVFICIRCAGIH
RNLGVHISRVKSVNLDQWTPEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIR
DKYEKKKYYDKNAIAITNKEKEKKKEEKKKEKEPEKPVKPLTTEKLQKKEDQQLEPKKST
SPKKAAEPTVDLLGLDGPAEAPVTNGNTTTVPSLNDDLDIFGPMISNPLPATVIPPAQGT
PSIPAAATLSTVISGDLDLFTEQATKSEEVAKKQLSKDSILSLYGTGTIQQQSTPGVFMG
PTNIPFTSQAPTAFQGFPSMGVPVPAPAPAAPGLLGNVMGQSASMMVGMPMPNGFMGNAQ
TGVMPLPPNVVGPQGGMVGQMGAPQSKFGLPQAQQPQWNLSQMNQQMAGMSISSTNPTVG
FGQPPNTTAGWSGSSSGQTLSTQLWK
Download sequence
Identical sequences A1EAA2
ENSCAFP00000003798 XP_005627065.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]