SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000003821 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000003821
Domain Number 1 Region: 32-158
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-42
Family Phosphotyrosine-binding domain (PTB) 0.000000947
Further Details:      
 
Domain Number 2 Region: 471-553
Classification Level Classification E-value
Superfamily SH3-domain 4.01e-16
Family SH3-domain 0.00027
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000003821
Domain Number - Region: 623-681
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000146
Family Pointed domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000003821   Gene: ENSCAFG00000002628   Transcript: ENSCAFT00000004134
Sequence length 710
Comment pep:known_by_projection chromosome:CanFam3.1:1:102518136:102528888:-1 gene:ENSCAFG00000002628 transcript:ENSCAFT00000004134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTSTGPEAAPKPSAKSIYEQRKRYSTVVMADVSQYLVNHLVTFCLGEEDGVHTVEDASR
KLAVMDNQGRVWAQEMLLRVSPDHVTLLDPISKEELESYPLGAIVRCDVVMLPGRSRSLL
LLVCQEPERTQPDVHFFQGLRLGAELIREDVQGALHDYRSGRGERRPAALRATQEELQRH
PSPAAETPPLQRSPSVRAVISIGEAGRGRPRAGPIPEVEEPQRPGQEGTSGNANPASPDL
GPRGPDLASLQAERDVDILNHVFDDVESFVSKLQKSAEAARVLEHRERGRRTRRRAAGEG
LLTLRAKPPSEAEYTDVLQKIKYAFSLLARLRGNIANPSSPELLHFLFGPLQLIVDTSGG
PRFASDVQRPHLTSEAVALLRDNLTPRENALWTSLGDSWTRPGLELSPKEGPPYSPEFSS
GWEPPATDPHGRAWEDPVEKQLQHERQRQQQSAPQVAVNGHQQPEAEPQQEPEGKWVLCN
YDFQARNSSELSVKQRDVLEVLDDRRKWWKVRDQQGQEGYVPYNILTPHPGLRGSCSQSA
SCSLDDAPPPPPAAPAPGPGSSRPPWDSCDILNMDPREKEKFSQMLFVNEELQARLAQGR
PGPSRAAPGPRAPEPQLSPHSDTSEVRTWLQAKGFSLGTVEALGVLTGAQLFSLQKEELR
AVSPEEGARVYSQVTVQRALLEDKEKVSELEAVMEKQKKKVEGDLETEVI
Download sequence
Identical sequences E2QUI7
ENSCAFP00000003821 ENSCAFP00000003821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]