SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000003895 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000003895
Domain Number 1 Region: 215-295,331-524
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.74e-26
Family Pectin methylesterase 0.053
Further Details:      
 
Domain Number 2 Region: 609-771
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.67e-24
Family Pectate lyase-like 0.062
Further Details:      
 
Domain Number 3 Region: 103-186
Classification Level Classification E-value
Superfamily F-box domain 4.84e-21
Family F-box domain 0.0021
Further Details:      
 
Domain Number 4 Region: 527-639
Classification Level Classification E-value
Superfamily Pectin lyase-like 9.07e-17
Family Galacturonase 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000003895   Gene: ENSCAFG00000002669   Transcript: ENSCAFT00000004211
Sequence length 872
Comment pep:known_by_projection chromosome:CanFam3.1:10:49839202:49954200:-1 gene:ENSCAFG00000002669 transcript:ENSCAFT00000004211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HPIPASSPPPPLPYYLALYSKADDDVPADMVAEESGPGAQNSPYQLRRKTLLPKRTACPT
KSSMEGASTSTTENFGHRAKRARVSGKSQDLSAAPAEQYLQEKLPDEVVLKIFSYLLEQD
LCRAACVCKRFSELANDPILWKRLYMEVFEYTRPMMHPEPGKFYQINPEEYEHPNPWKES
FQQLYKGAHVKPGFAEHFYSNPARYKGRENMLYYDTIEDALGGVQEAHFDGLIFVHSGIY
TDEWIYIESPITMIGAAPGKVADKVIIENTRDSTFVFMEGSEDAYVGYMTIRFNPDDKSA
QHHNAHHCLEITVNCSPIIDHCIIRSTCTVGSAVCVSGQGACPTIKHCNISDCENVGLYI
TDHAQGIYEDNEISNNALAGIWVKNHGNPIIRRNHIHHGRDVGVFTFDHGMGYFESCNIH
RNRIAGFEVKAYANPTVVRCEIHHGQTGGIYVHEKGRGQFIENKIYANNFAGVWITSNSD
PTIRGNSIFNGNQGGVYIFGDGRGLIEGNDIYGNALAGIQIRTNSCPIVRHNKIHDGQHG
GIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRIHSGKQVGVYFYDNGHGVLED
NDIYNHMYSGVQIRTGSNPKIRRNKIWGGQNGGILVYNSGLGCIEDNEIFDNAMAGVWIK
TDSNPTLRRNKIHDGRDGGICIFNGGRGLLEENDIFRNAQAGVLISTNSHPVLRKNRIFD
GFAAGIEITNHATATLEGNQIFNNRFGGLFLASGVNVTMKDNKIMNNQDAIEKAVSRGQC
LYKISSYTSYPMHDFYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTL
SNPCTLAGEPTHDTDTLYDSAPPIESNTLQHN
Download sequence
Identical sequences F1PLE4
ENSCAFP00000003895 ENSCAFP00000003895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]