SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000004064 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000004064
Domain Number 1 Region: 17-149
Classification Level Classification E-value
Superfamily PH domain-like 5.21e-32
Family Pleckstrin-homology domain (PH domain) 0.000000478
Further Details:      
 
Domain Number 2 Region: 171-267
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000176
Family SH2 domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000004064   Gene: ENSCAFG00000002756   Transcript: ENSCAFT00000004394
Sequence length 293
Comment pep:known_by_projection chromosome:CanFam3.1:13:58100496:58133701:1 gene:ENSCAFG00000002756 transcript:ENSCAFT00000004394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAKKPPKPAPRRIFQERLKITSLPLYFEGFLLVKRSEYQEYKHYWTELRGTTLFFYSDK
KSPKYVDKLDIIDLTCLTDQNSTEKNCANFTLVLPKEEVQLKTENTESGEEWRGFILTVT
ELSVPLHMSLLPGQVIRLHEVLEREKKRRIETEQMPSSALGKEKEPVEDYVDVLSPMPVC
FYSVSRKEATEMLEKNPSLGNMILRPGSDSKSYSITIRQEIDLPRIKHYKVMSVGKNYTI
ELERPVTLPNLFSVIDYFMKETRGNLRPFIYSTDETLETKGFPATSLKLKKNV
Download sequence
Identical sequences E2QUQ1
XP_005628306.1.84170 9615.ENSCAFP00000004064 ENSCAFP00000004064 ENSCAFP00000004064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]