SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000004328 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000004328
Domain Number 1 Region: 14-219
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-53
Family Pleckstrin-homology domain (PH domain) 0.0000000057
Further Details:      
 
Domain Number 2 Region: 286-357
Classification Level Classification E-value
Superfamily SH3-domain 4.86e-16
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000004328   Gene: ENSCAFG00000002921   Transcript: ENSCAFT00000004676
Sequence length 359
Comment pep:known_by_projection chromosome:CanFam3.1:14:39913427:40092188:-1 gene:ENSCAFG00000002921 transcript:ENSCAFT00000004676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNPSSTSSPYPLPEEIRNLLADVETFVADTLRGENLSKKAKEKRESLIKKIKDVKSTYL
QEFQDKGDAEDGEEYDDPFAGASDTMSLASERYDKDDEAHSEGNQFPPIAAQDLPFVLKA
GYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYNVRMNNTLRKD
GKKDCCFEISAPDKRIYQFTAASPKDAEEWVQQLKFVLQDMGSDVIPEDDDERGELYDDV
DHPLPTSSPPASSQPTDDEIYEELPEEEEDSAPAKVEEQRKMSQDNVHPTTGDKSTDYAN
FYQGLWDCTGALSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPKAYIMEMYDI
Download sequence
Identical sequences F1Q0B6
ENSCAFP00000004328 XP_005628710.1.84170 XP_539483.2.84170 ENSCAFP00000004328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]