SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000004444 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCAFP00000004444
Domain Number - Region: 1-45
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.000146
Family Pyk2-associated protein beta ARF-GAP domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000004444   Gene: ENSCAFG00000002993   Transcript: ENSCAFT00000004798
Sequence length 349
Comment pep:known_by_projection chromosome:CanFam3.1:15:2569522:2585050:-1 gene:ENSCAFG00000002993 transcript:ENSCAFT00000004798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEMGNGKANRLYEAYLPETFRRPQIDPAVEGFIRDKYEKKKYMDRSLDINAFRKEKDDK
WKRGSEPAPEKKMEPVVFEKVKMPQKKEDPQLPRKSSPKSSAPVMDLLGLDAPVSCSIAN
SKTSNTLEKDLDLLASVPSPSSSVSRKVVGSMPTAGSAGSVPENLNLFPEPGSKSEETGK
KQLSKDSILSLYGSQTPQMPAQAMFMAPAQMAYPTAYPSFPGVTPPNSIMGSMMPPPVGM
VAQPGASGMVAPMAMPAGYMGGMQASMMGVPNGMMTTQQAGYMAGMAAVPQTMYGVQPAQ
QLQWNLTQMTQQMAGMNFCGAHGMLSYGQSMNGGNGQAANQTLSPQMWK
Download sequence
Identical sequences F1PYA8
XP_005628935.1.84170 XP_013975029.1.84170 XP_539575.3.84170 ENSCAFP00000004444 ENSCAFP00000004444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]