SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000004561 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000004561
Domain Number 1 Region: 324-517
Classification Level Classification E-value
Superfamily Glycolipid transfer protein, GLTP 4.18e-53
Family Glycolipid transfer protein, GLTP 0.0000467
Further Details:      
 
Domain Number 2 Region: 1-93
Classification Level Classification E-value
Superfamily PH domain-like 6.56e-22
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000004561   Gene: ENSCAFG00000003056   Transcript: ENSCAFT00000004922
Sequence length 519
Comment pep:known chromosome:CanFam3.1:14:42807290:42860101:1 gene:ENSCAFG00000003056 transcript:ENSCAFT00000004922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGVLYKWTNYLSGWQPRWFLLCGGILSYYDSPEDAWKGCKGSIQMAVCEIQVHSVDNTR
MDLIIPGEQYFYLKARSVAERQRWLVALGSAKACLTDSRTQKEKEFAENTENLKTKMSEL
RLYCDLLVQQVDKTKEVTTTGVSNSEEGIDVGTLLKSTCNTFLKTLEECMQIANAAFTSE
LLYRTPPGSPQLAMLKSSKMKHPIIPIHNSLERQMELNSCENGSLHMEINDGEEILMKNK
SSLYLKPEIDCSISSEENTDDNITVQGEIMKEEGEDNLGNHDSSLAQPASDSSSSPPESH
WEEGQEIIPTFFSTMNTSFSDIELLEDSGIPTEAFLASCYAVVPVLDKLGPTVFAPVKMD
LVGNIKKVNQKYITNKEEFTTLQKIVLHEVEADVAQVRNSATEALLWLKRGLKFLKGFLT
EVKNGEKDIQTALNNAYGKTLRQHHGWVVRGVFALALRAAPSYEDFVAALTIKEGDHQKA
AFSVGMQRDLSLYLPAMEKQLAILDTLYEVHGLESDEVV
Download sequence
Identical sequences D2KC46
ENSCAFP00000004561 NP_001161170.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]