SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000004577 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000004577
Domain Number 1 Region: 123-456
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.36e-96
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000292
Further Details:      
 
Domain Number 2 Region: 458-578
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 1.24e-29
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00023
Further Details:      
 
Domain Number 3 Region: 4-113
Classification Level Classification E-value
Superfamily Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 0.000000000000144
Family Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000004577   Gene: ENSCAFG00000003072   Transcript: ENSCAFT00000004938
Sequence length 578
Comment pep:known_by_projection chromosome:CanFam3.1:12:46993941:47047601:-1 gene:ENSCAFG00000003072 transcript:ENSCAFT00000004938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACGFRRSIACQLSRVLDLPPENLIKSISAVPISRKEEVADFQLSVDSLLENNNDHSRPD
TQVQARKLAEKLKCDSVVSEISTGQGTVNFKINRELLTKTVLQQVIKDGSKYGLKSELFS
GLPQKKIVVEFSSPNIAKKFHVGHLRSTIIGNFIANLKEALGHQVTRINYLGDWGMQFGL
LGTGFQLFGYEEKLQSSPLQHLFEVYVQVNKEAADDKNVAKSAHEFFQRLELGDTQALAL
WQKFRDLSIEEYVRVYKRLGVHFDEYSGESFYREKSQEVLKLLDSKGLLQKTIKGTAIVD
LSGNGDPSSICTLMRSDGTSLYATRDLAAAIDRMDKYNFDTMIYVTDKGQKKHFQQVFQM
LQIMGYDWAERCQHVPFGVVQGMKTRKGDVTFLEDVLNEIRLRMLQNMASLKTTKVLENP
QETAERVGLAALIIQDFKGLLLSDYQFSWDRVFQSRGDTGVFLQYTHARLHSLEETFGCG
YLNDFNTACLQEPQSVSILQHLLRFDEVLYRSSQDLQPRHIVSYLLTLSHLAGMAHKTLY
VKDSPPEVAGARLHLFRAVRSVLANGMKLLGITPVCRM
Download sequence
Identical sequences E2R9K6
ENSCAFP00000004577 ENSCAFP00000004577 XP_539032.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]