SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000004820 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000004820
Domain Number 1 Region: 977-1104
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-21
Family Pleckstrin-homology domain (PH domain) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000004820   Gene: ENSCAFG00000003243   Transcript: ENSCAFT00000005209
Sequence length 1121
Comment pep:known_by_projection chromosome:CanFam3.1:14:47805292:47855733:1 gene:ENSCAFG00000003243 transcript:ENSCAFT00000005209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPFTEKLLERTRARRENLQRKMAERPTAAARSMTHAKRAREPLSEANNQQPLPGSEEKS
CTKPSPSKKRCSDNTEVEVSNLENEKPVESVSAKPCPPSPAPPQAQPPAPAPVSDAEAAP
APVPGVRRGLNSRLEATTVSSVKTRMQKLAEQRRHWDNNDLTDDIPESSLISPMPSEEST
ASSPKPPLSDASATPVGRRGRLANLAATICSWEDDVSYSSAKQNSAQEQPGTTCLSKFSS
ASAASARINSSSVKQEATCCSQRDGEASLNKAPSSSAVGVSLNNAAISSSVKAASSPVKS
STISITDAKNCEGQNPELLQKTPLSSLKTDVVSKPIEKSTVSQTTRPKEELNREICQHSQ
SKDKSATSGGAGIKPFLERFGERCQEYSKQSPARSTPHRTPVITPNTKAIQERLFKQNAS
SSTTHLAQQLKQEREKELACLRGRFDKGNLWSAEKGENPRSKQLETKQEVHCQNTPLKKH
QAVSNTPSLPVTEKVTENQRPGKSSGTEPTGFTECKMTKSSPLKITLFLEEDKSLKVTSE
PKVEQQTEVVRETEMSVDDDDDINSSKVINDIFSDVLVEGELDVEKSEEEMDHEDALNIS
SMSLLAPLAQTVGVVSPESLVSSPRLELKDASVSDESPKPGKFQRTRVPRAESGDSIGSE
DRDLLYSIDAYRSQRFKETERPSIKQVIVRKEDVTSKLDEKKNAFPGQVNIKQKMQELNN
EINLQQTVIYQASQALNCCVDEDHGKGSLEEAEAERLLLIATEKRTLLIDELNKLKNEGP
QRKNKTSPVAPSEFVPSKGSVTLSEIRLPLKADFVCGTVQKPDAANYYFLIILKAGAENM
VATPLACTSNSLNGDALTFTTTFTLQDVSNDFEINIEVYSLVQKKDLSGPDKKKKAYKSK
AITPKRLLTSITTKSSVHSSVMASPGGLNAVRTSNFALVGSYTLSLSSVGNTKFALDKVP
FLSPLEGHIYLKIKCQVNSSVEERGFLTIFEDVSGFGAWHRRWCVLSGNCISYWTYPDDE
KRKNPLGRINLANCTSHQIEPANREFCARRNTFELITVRPQREDDRETLVSQCRDTLCVT
KNWLSADTKEERDLWMQKLNQILVDIRLWQPDACYKPIGKP
Download sequence
Identical sequences F1PZ90
ENSCAFP00000004820 XP_539518.2.84170 ENSCAFP00000004820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]