SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000004848 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000004848
Domain Number 1 Region: 199-356
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.89e-36
Family BCR-homology GTPase activation domain (BH-domain) 0.00084
Further Details:      
 
Domain Number 2 Region: 37-147
Classification Level Classification E-value
Superfamily PH domain-like 6.3e-30
Family Pleckstrin-homology domain (PH domain) 0.00000685
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000004848   Gene: ENSCAFG00000003268   Transcript: ENSCAFT00000005238
Sequence length 644
Comment pep:known_by_projection chromosome:CanFam3.1:10:67636879:67686070:1 gene:ENSCAFG00000003268 transcript:ENSCAFT00000005238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSRRAPQNWQASARVSPAARSRSVMTGEQMATLHLPAPSPLQRPVKMGWLKKQRSIVKNW
QQRYFVLRAQQLCYYKDEEDGKPQGCLYLPGGTIKEIATNPEEAGKFVFEVIPASWDQSR
TGQDSYVLMASSQAEMEEWVKFLRRVAGTPSGGVCGISKQEQTAINKQANPLPVPVLRGG
CPGAVLERSPGNGTQGPARVPGQRERGAGLHQRFDAYVHPSKSRDTDVHTVASLLKLYLR
DLPEPVVPWSQYEGFLLCGQLMNADEAKAQQELVKQLSLLPRDNYSLLSYLCRFLHEIQL
NCAVNKMSVDNLATVIGVNLIRSKVEDPAVIMRGAPQIQRVMTMMIRDHEVLFPKSKDVP
LSPPAQKNDPKKPPVARSSVGWDATEDPPISRADSFSNTTSNSDATSPTGQQPSDGCLEE
SSKAPREKLGDWKLQSRKRTQTLPNRKCFLTSAFQGANSGKVEIFKNEFWSPSDVKAGEG
HRRTLSQGVPHYPDAQRTSTYDNVPTLPGPTGEEAAAASSPACDSKRETLASPSSETGPE
KKNSGEEKLESLQTVVQKLRKEIETQKQKYEEQIENLEKENYDVWAKVVRLNEELEKEKK
KFAALEISLRNVERSREDVERRNKALEEEVKEFVKSMKEPKADA
Download sequence
Identical sequences F1PYS3
ENSCAFP00000004848 ENSCAFP00000039814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]