SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000004856 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000004856
Domain Number 1 Region: 986-1116
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 9.81e-46
Family Regulator of G-protein signaling, RGS 0.00000618
Further Details:      
 
Domain Number 2 Region: 74-197
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.38e-22
Family Synaptotagmin-like (S variant) 0.0037
Further Details:      
 
Domain Number 3 Region: 229-310
Classification Level Classification E-value
Superfamily PDZ domain-like 2.93e-17
Family PDZ domain 0.0000143
Further Details:      
 
Domain Number 4 Region: 488-591
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000246
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000004856   Gene: ENSCAFG00000003267   Transcript: ENSCAFT00000005247
Sequence length 1122
Comment pep:known_by_projection chromosome:CanFam3.1:11:67797928:67919272:1 gene:ENSCAFG00000003267 transcript:ENSCAFT00000005247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQDCLPRYRLHCGPRQSCEGVCNTTSLSVLSASCGLSPWMEWQGQHTSVLRKDAWMQTTP
ARRRIRHIQVQGAVGQLKLSIDARDRVLLLHIIEGKGLMSREPGICDPYVKISLIPEDNR
LRRQKTQTVPDCREPVFHEHFFFPVQEEDEQKRLLVTVWNRAGDSRQSGLIGCMSFGVKS
LLTPDKEISGWYYLLGEDLGRTKHLKVARRRLRPLRDPLLRTPGCGDAENGEKLKITIPR
GKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPVEHWKCVELAHEIRSC
PSEIILLVWRMVPQVKPGPDGGVLRRASCKSTHDLQSPPNKREKNCTHGAQARPEQRHSC
HLVCDSSDGLLLGGWERYTEVAKRGGQHTLPALSRATASTDPNYIILAPLNPGSQLLRPV
YQEDAIPEESGSPSKGKSYTGLGKKSRLMKTVQTMKGHGNYQNCPVMRPHAPHSSYGTYV
TLAPKVLVFPVFVQPLDLCNPARTLLLSEELLLYEGRNKAVEVTLFAYSDLLLFTKEDEP
GRCNVLRNPLYLQSVKLQEGSSEDLKFCVLYLAEKAECLFTLEAHSQEQKKRVCWCLSEN
IAKQQQLAASPLESKMFEPEADEKREMPLEEGKGLGAEDPPPSKDPSPGQESPSGQDVPP
NKDSSSGEEPSPGQESLSSKDSPSCKEPPPGQEASPSKDSPPCQEPPAAPALPPCQDLPA
GQEPPPSQDLPVTQDASAQEPAPSQDVPPSQVPPPAEETASSGDPPAASGDPPVAPRPTF
VIPEVRLDSAYSQKAGAEGGSPAEEEEDAEEAEEGDEGDEEEEEEDDTSDDNYGERREAK
RSSMIEGGQAEGGLSLRVQNSLRRRTHSEGSLLQEARGPCFASDTTLHCSGEGAAATWAM
PSPRTLKKELGRNGGSMHHLSLFFTGHRKLQDGNRVADDEHYSYKCTSAPRAKDMKNKLG
IFRRRNESPGAQPAGKADKMVKSFKPTSEEALKWGESLEKLLLHKYGLAVFQAFLRTEFS
EENLEFWLACEDFKKVKSQSKMAAKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVT
RGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL
Download sequence
Identical sequences F1PYR0
ENSCAFP00000037461 ENSCAFP00000004856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]