SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000005101 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000005101
Domain Number 1 Region: 158-248
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.2e-28
Family Ras-binding domain, RBD 0.00018
Further Details:      
 
Domain Number 2 Region: 275-406
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000156
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000005101   Gene: ENSCAFG00000003422   Transcript: ENSCAFT00000005505
Sequence length 442
Comment pep:known_by_projection chromosome:CanFam3.1:18:1896483:2014836:-1 gene:ENSCAFG00000003422 transcript:ENSCAFT00000005505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALAGCPDSFLHHPYYQDQVEQTPPPSPRDLAGPGFPAPADRLTGHQEDDVDLEALVNDV
NASLESLYPACSMQSETVPLLQNGQHARSQPPPAAPRPPQAQRSQPVHIVAVRRLQEEDQ
QLRTSSLPAIPNPFPELCGPGSPPVLTRGSLPPGQAAAKQDVKIFSEDGTSKVVEILADM
TARDLCQLLVYRSHCVDDNSWTLVEHHPHLGLERCLEDHELVVQVESTMASESKFLFRKN
YAKYEFFKNPTNFFPEQMVTWCQQSNGGHSQLLQNFLNSSSCPEIQGFLHVKELGRKSWR
KLYVCLRRSGLYCSTKGVSKEPRHLQLLAGLEESSVFSLTAGRKQYGAPTDHGFCIKPNK
VRNETKELRLLCAEDEQGRTCWMTACRLLKYGMLLYQNYRIPPQRKALLPSFSTPVRSVS
ENSLVAMDFNGQSGRVIETPAQ
Download sequence
Identical sequences F1PF51
ENSCAFP00000005101 ENSCAFP00000005101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]