SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000005107 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000005107
Domain Number 1 Region: 50-232
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.41e-47
Family Ankyrin repeat 0.00029
Further Details:      
 
Domain Number 2 Region: 273-334
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000124
Family SAM (sterile alpha motif) domain 0.022
Further Details:      
 
Domain Number 3 Region: 241-298,383-416
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000222
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000005107   Gene: ENSCAFG00000003419   Transcript: ENSCAFT00000005511
Sequence length 481
Comment pep:known_by_projection chromosome:CanFam3.1:14:56198017:56250032:-1 gene:ENSCAFG00000003419 transcript:ENSCAFT00000005511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGALRSQAVAGGGESSESEDDGWEIGYLDRAVQKLKGPLLPEEKNETFKKALTSGDTSLV
KELLDSGISVDSSFRYGWTPLMYAASVSNVELVRVLLDKGANASFDKDKQTILITACSAC
GSEEQILKCVELLLSRNADPNVPCRRLMTPIMYAARDGHPQVVALLVAHGAEVNTQDENG
YTALTWAARQGHKNVVLKLLELGANKMLQTKDGKTPSEIAKRNKHLEIFSFLSLTLNPLE
GKLQHLTKEETICKLLTMDSDKEKDHIFSSYTAFGDLEIFLHGLGLEHMMDLLKERDITL
RHLLTMQKDEFTKNGITSRDQQKILAALKELEVEEIKFGELPEVAKLEISGDEFLNFLLK
LNKQCGHLITAVQNIITELPVNSHKIVLEWASPRNFTSVCEELVSNVEDLSEEVCKLKDL
IQKLQNERENDPTHIPLMEEVSTWNSRILKRTAITICGFGFLLFVCKILHRRNYDSIEQK
V
Download sequence
Identical sequences F1PF49
ENSCAFP00000005107 ENSCAFP00000037886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]