SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000005216 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000005216
Domain Number 1 Region: 1163-1383
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-54
Family DBL homology domain (DH-domain) 0.00023
Further Details:      
 
Domain Number 2 Region: 1373-1531
Classification Level Classification E-value
Superfamily PH domain-like 6.02e-20
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 
Domain Number 3 Region: 1516-1581
Classification Level Classification E-value
Superfamily SH3-domain 4.2e-16
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000005216   Gene: ENSCAFG00000003503   Transcript: ENSCAFT00000005632
Sequence length 1604
Comment pep:known_by_projection chromosome:CanFam3.1:16:5648831:5673560:-1 gene:ENSCAFG00000003503 transcript:ENSCAFT00000005632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAEEPQHGALTPIPALAELSIIPEPLRRSSQTATLGPEAQEGWEPSSTWAEGRGLLEPQ
QGGLKDVKSCATESMTSFPEEAPAGVETDQEDTVGDTWDTPERQEPVPQSLADGRARTPA
HAERGACPFQGEHLDTVPVSRERGGGVEMELRPELTSLPGGTGHAEEEEVSPDTSAQPRS
GPPCEEHPAEPELPGDSVKQGEELRAAGAEESPGRGGLMCLLDAWGLEEQGLAEAAFREE
AAAGGDGRLGGQEQGGEQADGTGEQEQKQEQRRGRAMCAKHGERTGLSGELEGLRCSEQG
MEPRRQPGLQQGEEGNRETGGPEEGSGAAQNEEKWSVVGKSGQVTGRPEGRGLRGLRGKV
ASVEGREAEAVGSGEEEPENWDGDPLRGEGREGPTEEGEARDGPSTLALVASEVSSPCDL
FPDTCYPMTGTPGPREEPRAEEPSPVALPPPLESGGWSGRPASLPGSFPAGGSPAQEAAQ
DSQQEGPELGKRAVFGQGTQMVSAGTPATPPRTPHPPPSGPAEVSSRTTTSLSASPPVGS
PRREPFLAAHSPETSRATLRTTHAHHCGASETPPAALPGASSAEATVETPTSSIWAHPQG
PPGHPAGAVQHLRSNSFPGSHRTEPTPDLLGLSLSFSHSELPQRAPKPAIYGSVIPRRDR
KSGRDCRIIPESPSSLSTLGWDSQEFTSNLERSSSPCSTQPCGSPHTSASAPESPAYGSS
PPFISVDGRIPEPLPPPPPEKRHVHPSVVERDSHLHAGVATLKRCGHALPLAPGSGLHGP
PKGPLPPFPDPLVARQHRPLPSTPDTPTPTLTSFSRRLRYNKPLPPTPDLSQPHHSVSFS
NPRIYRPLPPVPIMDPPIEPPPLPPKSKGRSRSTQGELMNSGGRGKPRPVCQERTVSAPH
SVGRTSWPPAMGRSTDSLASTSRSKSEVSPGMAFSNVATLLSPSSPTTHWSLELQGPTCE
PGPSEESEAPARGSLRRSAPPEGANGLRRLDVGQARQSEKLSHPHLEKASSWPHRRDTGR
PLESVSGRVADPGEGSSKHKGWNRQGLRRPSILPEGSSDTRGPGVEKAPGPSDTIVFREK
KPKEVMGGFSRRRSKLINSSQLLYQEYSDVVLNKEIQSQQRLDSLGEATGPASPRQPRKA
LVSSESYLQRLSMASSGSLWQEIPVVRNSTVLLSMTHEDQKLQEAKFELIVSEASYLRSL
HVAVDHFQLSAPLRATLSNQEYQWLFSRLQDVREVSTTFLSDLEENFESNIFTFQVCDVV
LNHAPDFRRVYLPYVTNQTYQERTFQVLLNSNSSFREVLEKLESDPVCQRLSLKSFLILP
FQRITRLKLLLQNILKRTQPGSPEEAEATKAHHALEELIRDCNNNVQRMRRTEELIYLSQ
KIEFECKIFPLISQSRWLVKSGEVTALEFSLSPGLRRKLNTRPVHLHLFNDCLLLSRPRE
GSRFLVFDHAPFSSIRGEKCEMKLHGPHKNLFRLFLLHNAQGTQAEFLFSTETQSEKLRW
ISALAMPREELDLLECYDSPQVQCLRAYKPRENDELALEKADVVMVTQQSSDGWLEGMRL
SDGERGWFPMQQVEFISNREVRARNVSEAHRVKTAKLQLVEQQT
Download sequence
Identical sequences F1PGP2
XP_005629580.1.84170 XP_005629581.1.84170 XP_539834.3.84170 ENSCAFP00000005216 ENSCAFP00000005216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]