SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000005248 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000005248
Domain Number 1 Region: 11-153
Classification Level Classification E-value
Superfamily Cyclin-like 8.11e-35
Family Cyclin 0.0052
Further Details:      
 
Domain Number 2 Region: 155-251
Classification Level Classification E-value
Superfamily Cyclin-like 2.69e-30
Family Cyclin 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000005248   Gene: ENSCAFG00000003525   Transcript: ENSCAFT00000005668
Sequence length 284
Comment pep:known_by_projection chromosome:CanFam3.1:12:57739773:57759807:-1 gene:ENSCAFG00000003525 transcript:ENSCAFT00000005668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGIFSEHIYIHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQ
QVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLISAATSVLKTR
FSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRI
VNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYE
QWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS
Download sequence
Identical sequences F1PGM0
ENSCAFP00000005248 ENSCAFP00000005248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]