SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000005421 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000005421
Domain Number 1 Region: 1-162
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.19e-44
Family BAR domain 0.0000525
Further Details:      
 
Domain Number 2 Region: 497-573
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000187
Family SH3-domain 0.0000807
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000005421   Gene: ENSCAFG00000003617   Transcript: ENSCAFT00000005852
Sequence length 574
Comment pep:known_by_projection chromosome:CanFam3.1:18:11143478:11265154:1 gene:ENSCAFG00000003617 transcript:ENSCAFT00000005852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEASMKLTESLHEVYEPDWYGREDVKMVGEKCDVLWEDFHQKLVDGSLLTLDTYLGQFP
DIKNRIAKRSRKLVDYDSARHHLEALQSSKRKDESRISKAEEEFQKAQKVFEEFNVDLQE
ELPSLWSRRVGFYVNTFKNVSSLEAKFHKEIAVLCHKLYEVMTKLGDQHADKAFTIQGAP
SDSGPLRIAKTPSPPEEPSPIPSPTASPNHTLAPASPAPARPRSPSQTRKGPPVPPLPKV
TPTKELQQENIISFFEDNFVPEISVTTPSQNEVPEVKKEETLLDLDFDPFKPEVAPVGSV
GVTHSPMSQTLPWDLWTTSTDLVQPASGGTFNGFTQPQDTSLFTMQTDQSMICDLVIPGT
DADVTVGTSVSAAEEAPVEEAEADKAVLPPGEGAGVEEARPDTEATQAVDGDRSQLEEAE
AVAPLEKVIPSVVIEPASNNEGEGDHEAPAGAESMETPAAAAPGPTTELPELAPEPKAGE
DSQPLPSALAASEESLEVPPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQD
AGWLVGVKESDWLQYRDLATYKGLFPENFTRRLD
Download sequence
Identical sequences E2R0J7
ENSCAFP00000005421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]