SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000005478 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000005478
Domain Number 1 Region: 131-229
Classification Level Classification E-value
Superfamily Cyclin-like 0.0000000000442
Family Cyclin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000005478   Gene: ENSCAFG00000003678   Transcript: ENSCAFT00000005914
Sequence length 305
Comment pep:known_by_projection chromosome:CanFam3.1:2:1386652:1720006:-1 gene:ENSCAFG00000003678 transcript:ENSCAFT00000005914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEWTVTRLGLVYKADLNMEFNPSDHPRASTIFLSKSQTDVREKRKSLFINHHPPGQIAR
KYSSCSTIFLDDSTVSQPNLKYTIKCVALAIYYHIKNRDPDGRMLLDIFDENLHPLSKSE
VPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVYLERLLTYAEIDICPANWKRIV
LGAILLASKVWDDQAVWNVDYCQILKDITVEDMNELERQFLELLQFNINVPSSVYAKYYF
DLRSLAEANNLSFPLEPLSRERAHKLEAISRLCEDKYKDLRRPMRKRSASADNLTLPRWS
PAIIS
Download sequence
Identical sequences F1PHF7
ENSCAFP00000005478 ENSCAFP00000005478 XP_005616991.1.84170 XP_013976838.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]