SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000005746 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000005746
Domain Number 1 Region: 369-730
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 2.35e-118
Family Oxysterol-binding protein 0.0000114
Further Details:      
 
Domain Number 2 Region: 3-102
Classification Level Classification E-value
Superfamily PH domain-like 2.21e-23
Family Pleckstrin-homology domain (PH domain) 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000005746   Gene: ENSCAFG00000003849   Transcript: ENSCAFT00000006204
Sequence length 736
Comment pep:known_by_projection chromosome:CanFam3.1:15:9506723:9666312:-1 gene:ENSCAFG00000003849 transcript:ENSCAFT00000006204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASIMEGPLSKWTNVMKGWQYRWFVLDYNAGLLSYYTSKDKMMRGSRRGCVRLRGAVIGI
DDEDDSTFTITVDQKTFHFQARDADEREKWIHALEETILRHTLQLQGLDSGFVPSVQDFD
KKLTEADAYLQILIDQLKLFDDKLQNCKDDEQRKKIETLKETTNSMVESIKHCIVLLQIA
KDQCNAEKHADGIISTINPVDAIYQPSPLEPVINTMPTQTVLPPEPAQLCKSEQRPSSLP
VGPVLATLGHHQTPTPNSTGSGHSPPSSSLTSPSHVNLSPNTVPEFSYSSSEDEFYDADE
FHQSGSSPKRLIDSSGSASVLTHSSSGNSLKRPDTTESLNSSMSNGTSEADLFDSHDDRD
DEGEAGSVEEHKSVIMHLLSQVRLGMDLTKVVLPTFILERRSLLEMYADFFAHPDLFVSI
SDQKDARDRMVQVVKWYLSAFHAGRKGSVAKKPYNPILGEIFQCHWTLPNDTEENAELVS
EGPVPWVSKNCVTFVAEQVSHHPPISAFYAECFNKKIQFNAHIWTKSKFLGMSIGVHNIG
QGCVSCLDYDEHYILTFPNGYGRSILTVPWVELGGECNISCSKTGYSANIVFHTKPFYGG
KKHRITAEIFSPNDKKSFCSVEGEWNGVMYAKYATGENAVFIDTKKLPIIKKKVRKLEDQ
NEYESRCLWKDVTFNLKIRDIDAATEAKHRLEEKQRAEARERKEKEIQWETRLFHEDGEC
WVYDEPLLKRLGAAKH
Download sequence
Identical sequences E2RT18
9615.ENSCAFP00000005746 ENSCAFP00000005746 ENSCAFP00000005746 XP_849727.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]