SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000005925 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000005925
Domain Number 1 Region: 2-235
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.4e-60
Family BAR domain 0.0041
Further Details:      
 
Domain Number 2 Region: 343-520
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.35e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.00000122
Further Details:      
 
Domain Number 3 Region: 209-316
Classification Level Classification E-value
Superfamily PH domain-like 4.99e-16
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 4 Region: 764-819
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000446
Family SH3-domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000005925   Gene: ENSCAFG00000003991   Transcript: ENSCAFT00000006400
Sequence length 820
Comment pep:known_by_projection chromosome:CanFam3.1:21:596944:820680:-1 gene:ENSCAFG00000003991 transcript:ENSCAFT00000006400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVQKFSQSLQDFQFECIGDAETDDEISIAQSLKEFARLLIAVEEERRRLIQNANDVLIA
PLEKFRKEQIGAAKDGKKKFDKESEKYYSILDKHLNLSAKKKESHLQEADIQVDREHQNF
YEASLEYVFKIQEVQEKKKFEFVEPLLSFLQGLFTFYHEGYELAQEFAPYKQQLQFNLQN
TRNNFESTRQEVERLMQRMKSANQDYRPPSQWTMEGYLYVQEKRPLGFTWIKHYCTYDKG
SKTFTMSVSEMKSSGKMNGLVTGSPEMFKLKSCIRRKTDSIDKRFCFDIEVVERHGIITL
QAFSEANRKLWLEAMDGKEPIYTLPAIISKKEEMYLNEAGFNFVRKCIQAVETRGITVLG
LYRIGGVNSKVQKLMNTTFSPKSPPDIDIDIELWDNKTITSGLKNYLRCLAEPLMTYKLH
KDFIVAVKSDDQNYRVEAVHALVHKLPEKNREMLDILIKHLVKVSLHSQQNLMTVSNLGV
IFGPTLMRAQEETVAAMMNIKFQNIVVEILIEHYEKIFHTAPDPSVPLPQPQSRSGSRRT
RAICLSTGSRKPRGRYTPCLAEPDSDSYSSSPDSTPMGSIESLSSHSSEQNSTTKSASCQ
PREKSGGIPWIVSPSPSNGQKSLGIWATSPESSSKEDATKTDAESDCQSVASITSPGDVY
PPIDLVRKGPYGLSGLKRASASSLRSISAAEGNKSYGGSIQSLTSVGFKEMPKAPSNPDL
PPKMCRRLRLDTASSNGYQRPGSVVAAKAQLFENAGSLKLISSGRQAKAMYSCKAEHSHE
LSFPQGAIFSNVYPSVEPGWLKATYEGKTGLVPENYVVFL
Download sequence
Identical sequences F1P6K3
ENSCAFP00000005925 ENSCAFP00000005925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]