SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000006002 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000006002
Domain Number 1 Region: 1190-1412
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-62
Family DBL homology domain (DH-domain) 0.0000000263
Further Details:      
 
Domain Number 2 Region: 1412-1553
Classification Level Classification E-value
Superfamily PH domain-like 4.98e-31
Family Pleckstrin-homology domain (PH domain) 0.00000152
Further Details:      
 
Domain Number 3 Region: 231-333
Classification Level Classification E-value
Superfamily EF-hand 1.96e-27
Family Eps15 homology domain (EH domain) 0.0024
Further Details:      
 
Domain Number 4 Region: 1103-1188
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-27
Family SH3-domain 0.00000345
Further Details:      
 
Domain Number 5 Region: 1567-1687
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.08e-26
Family PLC-like (P variant) 0.004
Further Details:      
 
Domain Number 6 Region: 8-107
Classification Level Classification E-value
Superfamily EF-hand 6.92e-26
Family Eps15 homology domain (EH domain) 0.0019
Further Details:      
 
Domain Number 7 Region: 869-958
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-19
Family SH3-domain 0.0000161
Further Details:      
 
Domain Number 8 Region: 980-1040
Classification Level Classification E-value
Superfamily SH3-domain 3.28e-19
Family SH3-domain 0.0000354
Further Details:      
 
Domain Number 9 Region: 760-829
Classification Level Classification E-value
Superfamily SH3-domain 1.09e-18
Family SH3-domain 0.0000328
Further Details:      
 
Domain Number 10 Region: 1048-1120
Classification Level Classification E-value
Superfamily SH3-domain 4.33e-16
Family SH3-domain 0.0000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000006002   Gene: ENSCAFG00000004019   Transcript: ENSCAFT00000006481
Sequence length 1697
Comment pep:known_by_projection chromosome:CanFam3.1:17:18628255:18729895:-1 gene:ENSCAFG00000004019 transcript:ENSCAFT00000006481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAQFPTAMNGGPNMWAITSEERTKHDKQFDNLKPSGGYITGDQARTFFLQSGLPAPVLA
EIWALSDLNKDGKMDQQEFSIAMKLIKLKLQGQQLPVVLPPIMKQPPMFSPLISARFGMG
SMPNLSIPHSLPPVAPMTTPLSSATSGTTLPPVMMPAPLVPSVSTSSLPNGTPGLIQPLS
IPYSSSTLPHTSSYSLMMGGLGGASLQKAQSLIDLGSSSSTSSTASLSGNSPKTGTSEWA
VPQPSRLKYRQKFNSLDKSMSGYLSGFQARNALLQSNLSQTQLATIWTLADIDGDGQLKA
EEFILAMHLTDMAKAGQPLPLTLPPELVPPSFRGGKQIDSINGTLPSYQKMQEEEPQKKL
PVTFEDKRKANYERGNVELEKRRQALMEQQQREAERKAQKEKEEWERKQRELQEQEWKKQ
LELEKRLEKQRELERQREEERRKEIERREAAKQELERQRRLEWERIRRQELLNQRNREQE
EIVRLNSKKKSLHLELEALNGKHQQISGRLQDVRLRKQTQKTELEVLDKQCDLEIMEIKQ
LQQELQDYQNKLIYLVPEKQLLNERIKNMQLGNTPDLGIGLLHKKSLEKEELCQRLKEQL
DALEKETASKLSEMDSFNNQLKCGNMDDSVLQCLLSLLSCLNNLFLLLKELRESYNTQQL
ALEQLHKIKRDKLKEIERKRSELIQKKKLEDEAIRKAKQGKENLWRESLRKEEEEKQKRL
QEEKAQEKVQEEERKVEEKQCKDKDRTMKAITKKGEPASALVNYKALYRFEARSHDEMSF
NSGDIIQVDEKTIGEPGWLYGSFQGNFGWFPCNYVEKMLSGEKSVSPKKALLPPTVSVSA
TSTSSESLSSNQPASVTDYQNVSFTNLTVNTSWQKKSAFTRTVSPGSISPIHGQGQVVEN
LKAQALCSWTAKKDNHLNFSKHDIITVLEQQENWWFGEVHGGRGWFPKSYVKIIPGSEVK
REEPETLYAAVNKKPTSAAYTVGEEYIALYSYSSVEPGDLTFTEGEEILVTQKDGEWWTG
SIGDRTGIFPSNYVKPKDQENFGSASKSGTSNKKPEIAQVTSAYVASGSEQLSLAPGQLI
LILKKNSSGWWQGELQARGKKRQKGWFPASHVKLLGPSSERTTPAFHPVCQVIAMYDYAA
NNEDELNFSKGQLINVLNKDDPDWWQGEINGVTGLFPSNYVKMTTDSDPSQQWCADLQSL
DTMQPVERKRQGYIHELIQTEERYVDDLQLVVEVFQKRMAESGFLSEGEMALIFVNWKEL
IMSNTKLLKALRVRKKTGGEKMPVQMIGDILAAELSHMQAYIRFCSCQLNGAALLQQKTD
EDADFKEFLKKLASDPRCKGMPLSSFLLKPMQRITRYPLLIRSILENTLENHVDHSSLKL
ALEQAEELCSQVNEGVREKENSDRLEWIQAHVQCEGLAEQLIFNSLTNCLGPRKLLHSGK
LYKTKSNKELHGFLFNDFLLLTYMVKQFAVSSGSEKLFSSKSNAQFKMYKTPIFLNEVLV
KLPTDPPSDEPVFHISHIDRVYTLRTDNINERTAWVQKIKAASEQYIDTEKKKREKAYQA
RSQKTSGIGRLMVQVIEATELKACKPNGKSNPYCEISMGSQSYTTRTLPDTLNPKWNFNC
QFFIKDLYQDVLCLTMFDRDQFSPDDFLGRTEVPVAKIRTEQESKGPTTRRLLLHEVPTG
EVWVRFDLQLFEQKTLL
Download sequence
Identical sequences F1PR68
ENSCAFP00000006002 ENSCAFP00000006002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]