SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000006014 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000006014
Domain Number 1 Region: 641-836
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.46e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0000379
Further Details:      
 
Domain Number 2 Region: 458-570
Classification Level Classification E-value
Superfamily PH domain-like 5.88e-20
Family Pleckstrin-homology domain (PH domain) 0.0048
Further Details:      
 
Domain Number 3 Region: 9-83
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000147
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 4 Region: 256-295
Classification Level Classification E-value
Superfamily WW domain 0.00000000979
Family WW domain 0.0022
Further Details:      
 
Domain Number 5 Region: 360-388
Classification Level Classification E-value
Superfamily WW domain 0.0000208
Family WW domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000006014   Gene: ENSCAFG00000004045   Transcript: ENSCAFT00000006493
Sequence length 838
Comment pep:known_by_projection chromosome:CanFam3.1:2:14978193:15085584:1 gene:ENSCAFG00000004045 transcript:ENSCAFT00000006493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADRSGKIIPGQVYIEVEYDYEYEAKDRKIVIKQGERYILVKKTNDDWWQVKPDENSKAF
YVPAQYVKEVTRKALMPPVKQAVGLPNNSMKMIQSLHLQRSTENVNKLPELSSFGKPSSV
QGTGLTRDANQNFGPNYNPGQTVNLSLDLTHNNGKFNSDSHSPKVSGQNRTRLFGHSPGP
EFLDVEKTSFSQEQSCDSAGEGSERVHQDSESGDELSSSSTEQIRATTPPNQGRPDSPVY
ANLQELKISQSALPPLPGSPAIQINGEWETHKDSSGRCYYYNRGTQERTWKPPRWTRDTN
ISKGDFQSPGDQELLSSEENYHSICYNQSDSQCGSPPRGWSEELDERGHTLYTSDYTNEK
WLKHVDDQGRQYYYSADGSRSEWELPKYNASSQQQREIIKSRSLDRRLQEPIVLTKWRHS
TIVLDTNDKESPTASKPCFPENESSPSSPKHQDTGQEKYGLLNVTKITENGKKVRKNWLS
SWAVLQGSSLLFTKTQGSSTSWFGSNQSKPEFTVDLKGATVEMASKDKSSKKNVFELKTR
QGTELLIQSDNDTVINDWFKVLSSTINNQTVETDEAIEEEIPESPGIEKHDKEKDHKDPK
KLRPMKVSSIDSSEQKKTKKNLKKFLTRRPTLQAVREKGYIKDQVFGANLANLCQRENGT
VPNFVKLCIEHVEAYGLDVDGIYRVSGNLAVIQKLRFAVNHDEKLDLNDSKWEDIHVITG
ALKMFFRELPEPLFTFNHFNDFVNAIKQEPRQRVAAVKDLIRQLPKPNQDTMQILFRHLK
RVIENGEKNRMTYQSIAIVFGPTLLKPEKETGNIAVHTVYQNQIVELILLEINSIFGR
Download sequence
Identical sequences F1PR61
XP_859747.1.84170 ENSCAFP00000006014 ENSCAFP00000006019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]