SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000006080 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000006080
Domain Number 1 Region: 824-997
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.25e-34
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.034
Further Details:      
 
Domain Number 2 Region: 703-787
Classification Level Classification E-value
Superfamily WWE domain 0.000000131
Family WWE domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000006080   Gene: ENSCAFG00000004102   Transcript: ENSCAFT00000006568
Sequence length 1000
Comment pep:known_by_projection chromosome:CanFam3.1:16:9598405:9658535:1 gene:ENSCAFG00000004102 transcript:ENSCAFT00000006568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPEVCCFITKILCAHGGRMALDALLQEIALSEAQLREVLEAAGPDRFVLLETGDRAGV
TRAVVAATRARVCRRKFCQRPCEDLHLCKLNLLGRCHYSQAERNLCKYSHEVLSEENFKV
LKNHELSGLNKEELAVLLIQSDPFFLPEICKNYKGEGRRVICDKYPQCERLHICEHFTRG
NCGYANCLRSHNLMDRRVLAIMREHGLSPSVVQNIQDIFNNKHSRKKHSGYRAPPSYRRD
KAYRGRSKSRDRSFQGSTEFLPSAPAPAQKSCSSSPDPVGHRPPLDNVPVEDLAHKFGRL
GSQDCPQPSPVSPKANSLRGAGQVGGSRRFSENGSPEDLFYGHQDSIFFPSDSTPASNRK
GPDSGLNDKGTSRESVFSWSKATSGSVGSLQTPETITTRKSTGLLSPDGMSAEARGSNQN
AQYFPLFNNNVDGMATDGTSARSLNYKTTTRGQREKSLPRNQDAGTPPGNVQTTGTIMGG
DDPAAAPANGKVKPPWASKSVHGIPDGSSQVVGGSPPVSIGSQNLYTLVLPTPQETTVPT
VQVRTRFEMPLSMSSSGTRAAAYASHGQNSAQTPVSPASEFARTPRCAPYSAFDVGSTSS
SRMDDCDPQEICLDHLCKGCQTVSENCNKVHFHLPYRWQMFFANTWMDLQPMENIEKAYC
DPQIRIFSIGNKSIDFQKMTCNSIPIRRISTPSSVTTLTNFVFATKWIWYWKKESDIWVQ
YGEEAGNQEASNIDSSYLESFFLLYPRGIVPFQAGSRNYELSFIGMIQTNVASKTQKDVV
RRPTFMSYKDVEQIKSNYQLMQTLSEPLISTLPPQPDFSLNGYELVEINNQNPEYVMISE
SFKASMKNFKIENIKKIKNTKLLNAFERKKLKMNNRTEKILFCATRRTYVESICKDNFNW
IIHGSSDTKYGKGIYFTKDAIYSHKDQQDDTKNMVMFVARVLVGDFTQGYRESLNPPPPP
YDSYVDVRLNPSIFVIYEKDQIYPQYVIEYTEPEKACVIS
Download sequence
Identical sequences F6V7E9
ENSCAFP00000006080 ENSCAFP00000006080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]