SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000006129 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000006129
Domain Number 1 Region: 175-306
Classification Level Classification E-value
Superfamily Cyclin-like 1.49e-50
Family Cyclin 0.000000499
Further Details:      
 
Domain Number 2 Region: 309-430
Classification Level Classification E-value
Superfamily Cyclin-like 7.71e-37
Family Cyclin 0.000000587
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000006129   Gene: ENSCAFG00000004133   Transcript: ENSCAFT00000006621
Sequence length 432
Comment pep:known_by_projection chromosome:CanFam3.1:19:18318004:18323422:1 gene:ENSCAFG00000004133 transcript:ENSCAFT00000006621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGSSEPGPEAREAGSSLLTLQHTALQEDQENINPEKAAPAQQPRTRAGLAVLKAGNQRV
PAPQQRPKTRRVAPLKDLPINDEQVTIPPWKANSKQPAFTIHVDETEEETQKRPAESKKT
EHENVLAFNSAITLPGPRKPLVPLDYPMDGSFESPHTMDISIVLEDEKPLSVNEVPDYHE
DIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYID
RFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLK
VLAFDLAAPTVNQFLTQYFLHQQSANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAF
HLALYTVTGQSWPESLVQKTGYTLESLKPCLMDLHQTYLRAPQHAQQSIREKYKSSKYHG
VSLLNPPETLNV
Download sequence
Identical sequences E2RQA2
9615.ENSCAFP00000006129 ENSCAFP00000006129 XP_540965.2.84170 ENSCAFP00000006129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]