SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000006137 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000006137
Domain Number 1 Region: 187-269
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-21
Family SH3-domain 0.00011
Further Details:      
 
Domain Number 2 Region: 2-30
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000332
Family LASP-1 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000006137
Domain Number - Region: 32-59
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000438
Family LIM domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000006137   Gene: ENSCAFG00000004130   Transcript: ENSCAFT00000006629
Sequence length 270
Comment pep:known_by_projection chromosome:CanFam3.1:2:11891943:12229221:1 gene:ENSCAFG00000004130 transcript:ENSCAFT00000006629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPQCARCGKVVYPTEKVNCLDKYWHKGCFHCEVCKMALNMNNYKGYEKKPYCNAHYPKQ
SFTTVADTPENLRLKQQSELQSQVKYKRDFEESKGRGFSIVTDTPELQRLKRTQEQISNV
KYHEDFEKTKGRGFTPVVDDPVTERVRKNTQVVSDAAYKGVHPHIVEMDRRPGIIVAPVL
PGAYQQSHSQGYGYMHQTSLSSMRSMQHSPNLRTYRAMYDYSAQDEDEVSFRDGDYIVNV
QPIDDGWMYGTVQRTGKTGMLPANYIEFVN
Download sequence
Identical sequences F1PQ88
ENSCAFP00000006137 XP_004393030.1.74151 XP_007189932.1.59432 XP_007457481.1.90284 XP_012392605.1.21590 XP_012914368.1.14098 XP_013977365.1.84170 XP_019788935.1.83887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]