SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000006261 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000006261
Domain Number 1 Region: 178-390
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-59
Family DBL homology domain (DH-domain) 0.0000000769
Further Details:      
 
Domain Number 2 Region: 375-531
Classification Level Classification E-value
Superfamily PH domain-like 2.68e-49
Family Pleckstrin-homology domain (PH domain) 0.00000245
Further Details:      
 
Domain Number 3 Region: 83-200
Classification Level Classification E-value
Superfamily SH3-domain 3.28e-22
Family SH3-domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000006261   Gene: ENSCAFG00000004213   Transcript: ENSCAFT00000006766
Sequence length 591
Comment pep:known_by_projection chromosome:CanFam3.1:19:20634115:20732443:1 gene:ENSCAFG00000004213 transcript:ENSCAFT00000006766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QCWRKVTITSPESLSLARRSHPFSQSAPTGLNCMGWPQYIPDTAIPDGVLDTAIRADEAG
SEEDLYEDMHSSSHHYSHPGGGGEQLAINELISDGSVVCAEALWDHVTMDDQELGFKAGD
VIEVMDATNREWWWGRVADGEGWFPASFVRLRVNQDEPADDAAVRAGDGGAEDRGAEAQS
SRDQMRTNVINEILSTERDYIKHLRDICEXXXRQCRKRADMFSEEQLRTIFGNIEDIYRC
QKAFVKALEQRFNRERPHLSELGACFLEHQADFQIYSEYCNNHPNACVELSRLTKLSKYV
YFFEACRLLQKMIDISLDGFLLTPVQKICKYPLQLAELLKYTPPQHRDFKDVEAALHAMK
NVAQLINERKRRLENIDKIAQWQSSIEDWEGEDLLVRSSELIYSGELTRVTQPQAKSQQR
MFFLFDHQLIYCKKDLLRRDVLYYKGRVDMDGLEVVDLEDGKDRDLHVSVKNAFRLLCGT
TGESHLLCARKPEQKQRWLKAFAREREQVQLDQETGFSITELQRKQAMLNASKQQATGKP
KALSRPYYLTRQKHPALPTSLPQQQVLVLAEPKRKPSTFWHSISRLAPFRK
Download sequence
Identical sequences F1PPF4
ENSCAFP00000006261 ENSCAFP00000006261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]