SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000006267 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000006267
Domain Number 1 Region: 3-105
Classification Level Classification E-value
Superfamily PH domain-like 7.4e-22
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000006267   Gene: ENSCAFG00000004224   Transcript: ENSCAFT00000006772
Sequence length 221
Comment pep:known_by_projection chromosome:CanFam3.1:19:20809765:20847873:1 gene:ENSCAFG00000004224 transcript:ENSCAFT00000006772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRQSIEDKVHMPVDCINIRTGH
ECRDIQPPDGKPKECMLQIVCRDGKTISLCAESTDDCLAWKFTLQDSRINTAYVGSEVLY
DETTVASSPPPYTAYATPTPETYGCGPYSGAYPPGTQVVYAANGQAYAVPYQYPYAGLYG
QQPANQVIIQERYRDNDSDLALGMLAGAATGMALGSLFWVF
Download sequence
Identical sequences E2RSD9
ENSCAFP00000006267 XP_540978.2.84170 ENSCAFP00000006267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]