SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000006427 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000006427
Domain Number 1 Region: 169-268
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-33
Family Ras-binding domain, RBD 0.0025
Further Details:      
 
Domain Number 2 Region: 311-425
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000225
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000006427   Gene: ENSCAFG00000004329   Transcript: ENSCAFT00000006944
Sequence length 663
Comment pep:known_by_projection chromosome:CanFam3.1:2:7151443:7212200:-1 gene:ENSCAFG00000004329 transcript:ENSCAFT00000006944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGESNDDIDQMFSNLLGEMDLLTQSLGVDTLPPPESKPPRAEFNYSVGFKDLNESLNALE
DQDLDALMADLVADISEAEQRTIQAQKESSQNQHHPASVEVPDFSGAAALSYGANVTAIS
VSQYENDLPPPPADPMLNLPLPPPPPEPLSQEEEAAQAKADKIKLALEKLKEAKVKKLVV
KVHMNDNSTKSLMVDERQLARDVLDNLFEKTHCDCNVDWCLYEIYPELQIERIFEDHENV
VEVLSDWTRDTENKVLFLEKEEKYAVFKNPQNFYLNNKGRKEGKETNEKMNAKNKESLLE
ESFCGTSIIVPELEGALSLKEDGKKTWKRRYFLLRASGIYYVPKGKTKTSRDLACFIQFE
NVNIYYGIQCKMKYKAPTDYCFVLKHPQIQKESQYIKYLCCDDARTLNQWVMGIRIAKYG
KTLYDNYQRAMARAGLASRWTNQSTVSTAPPATSAAPSTGLKTSTPQANGQIPQAAHSVS
AVLEEAQRHVETTKDKKPALGNQGPGAPEVHQLPKSSLPPPPPVRRSSDVCSSPATAARA
RGLGGGFPAPAPPEDSLPPPPPPPPLDEDELPPPPPDFHDAPPDFVPPPPPSFAGDVGSA
LPPPPPPPPAPEAARPPRVALKRPPAPPKRKESPGPAVGGGSGEQDFMSDLMKALQKKRG
NMS
Download sequence
Identical sequences E2RPD3
XP_005617039.1.84170 XP_535169.3.84170 ENSCAFP00000006427 ENSCAFP00000006427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]