SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000006438 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000006438
Domain Number 1 Region: 349-456
Classification Level Classification E-value
Superfamily SH2 domain 1.14e-31
Family SH2 domain 0.00000331
Further Details:      
 
Domain Number 2 Region: 55-162
Classification Level Classification E-value
Superfamily SH2 domain 6.19e-31
Family SH2 domain 0.00000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000006438   Gene: ENSCAFG00000004331   Transcript: ENSCAFT00000006956
Sequence length 461
Comment pep:known chromosome:CanFam3.1:15:14235828:14353814:1 gene:ENSCAFG00000004331 transcript:ENSCAFT00000006956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAITNGMKDSSISL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEY
IERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEDADETYFINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR
Download sequence
Identical sequences E2RPB0
9615.ENSCAFP00000006438 XP_013975046.1.84170 ENSCAFP00000006438 ENSCAFP00000006438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]