SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000006594 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000006594
Domain Number 1 Region: 1-114
Classification Level Classification E-value
Superfamily PH domain-like 4.14e-47
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000138
Further Details:      
 
Domain Number 2 Region: 344-383
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.000000000000129
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000006594   Gene: ENSCAFG00000004420   Transcript: ENSCAFT00000007121
Sequence length 385
Comment pep:known chromosome:CanFam3.1:1:110050154:110062827:-1 gene:ENSCAFG00000004420 transcript:ENSCAFT00000007121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSETVICSSWATVMLYDDSNKRWLPAGTGPQSFSRVQIYHNPTANSFRVVGWKMQPDQQV
VINCAIVRGIKYNQATPTFHQWRDARQVWGLNFGSKEDATQFAAAMASALEALEGGGPPP
PPPPAAPPTWSVQNGPASEEVEQQKRQQPGPPEHLERRVSNAGGPPAPPAGGPPPPPGPP
PPPGPPPPPGVSLSGGSAAGHGAGGGPPPAPPLPTAQGTSGGGTGAPGLAAAIAGAKLRK
VSKQEEASGGPPVPKAESTRSTGGGLMEEMNAMLARRRKATQVGEKPPKDESANQEEPEA
RVPVPAQSETVRRPWEKNSTTLPRMKSSSSVTTSEAHPSTPSSSDESDLERVKQELLEEV
RKELQKVKEEIIEAFVQELRKRGSP
Download sequence
Identical sequences F1PRR4
XP_005615785.1.84170 ENSCAFP00000006594 9615.ENSCAFP00000006594 ENSCAFP00000006594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]