SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000006618 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000006618
Domain Number 1 Region: 383-576
Classification Level Classification E-value
Superfamily Cyclin-like 2.69e-70
Family Retinoblastoma tumor suppressor domains 0.00000000919
Further Details:      
 
Domain Number 2 Region: 645-784
Classification Level Classification E-value
Superfamily Cyclin-like 1.59e-57
Family Retinoblastoma tumor suppressor domains 0.00000019
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000006618
Domain Number - Region: 62-141
Classification Level Classification E-value
Superfamily Cyclin-like 0.0119
Family Transcription factor IIB (TFIIB), core domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000006618   Gene: ENSCAFG00000004436   Transcript: ENSCAFT00000007150
Sequence length 928
Comment pep:known_by_projection chromosome:CanFam3.1:22:3063451:3206499:-1 gene:ENSCAFG00000004436 transcript:ENSCAFT00000007150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPPPTPTPAPPPAPAPAPPAPAPPAPPPAPPPAPAPPNDGTIKNFPVSRLVFEETEEPDF
TALCQKLKIPDHVRERAWLTWEKVSSVDGVLEGYVQRKKELWGICIFIAAVDLDEMPFTF
TELQKTIEISVYRFFDLLKEIDTSTKVDNAMSRLLKKYDVLCALYSKLERTCELIYLTQP
SSLISTEINSVLVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPALLKE
PYKTAVIPFNGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFI
PFMNSLGIVASNGLPEVESLSRQYEEIYLKNKDFDARLFLDHDKTLQIDPTDSFEMQRTP
QKSNSDEEVNVILPQTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILK
RVKDVGYIFKEKFAKAVGQGCMEIGSQRYKLGVRLYYRVMESMLKSRLSIQNFSKLLNDD
IFHMSLLACALEVVMATYSRSTSQNLDTGTDLSFPWILNVLNLKAFDFYKVIESFIKAEA
NLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQAKDREGPADHLESACTLNLPLQSNH
TAADMYLSPVRSPKKKGSTIRVNSTVNTEAQATSAFQTQKPLKSTSLSLFYKKVYRLAYL
RLNTLCARLLSDHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLK
FKIIVTAYKDLPHAVQETFKRVLIREEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLS
PIPHIPRSPYKFSSSPLRIPGGNIYISPLKNPYKISEGVPTPTKMTPRSRILVSIGESFG
TSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQK
LAEMTSTRTRMQKQKLNDSMDTSNREEK
Download sequence
Identical sequences F1PQ32
ENSCAFP00000006618 ENSCAFP00000006618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]