SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000007060 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000007060
Domain Number 1 Region: 274-407,709-884
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 6.1e-53
Family Diacylglycerol kinase-like 0.013
Further Details:      
 
Domain Number 2 Region: 7-129
Classification Level Classification E-value
Superfamily PH domain-like 2.55e-29
Family Pleckstrin-homology domain (PH domain) 0.0037
Further Details:      
 
Domain Number 3 Region: 1088-1153
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.57e-19
Family SAM (sterile alpha motif) domain 0.0035
Further Details:      
 
Domain Number 4 Region: 176-244
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.59e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000483
Further Details:      
 
Domain Number 5 Region: 113-170
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000359
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000007060   Gene: ENSCAFG00000004733   Transcript: ENSCAFT00000007625
Sequence length 1162
Comment pep:known_by_projection chromosome:CanFam3.1:22:8543757:8756872:-1 gene:ENSCAFG00000004733 transcript:ENSCAFT00000007625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAILYTSIKEGQLLKQTSSFQRWKKRYFKLRGRTLYYAKDSKSLIFDEVDLSDASVAEA
STKNANNSFTIITPFRRLMLCAENRKEMEDWMSSLKSVQTREPYEVAQFNVEHFSGMHNW
YACSHARPTFCNVCRESLSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDII
EDEDGVAMPHQWLEGNLPVSAKCAVCDKTCGSVLRLQDWKCLWCKTMVHTACKDLYHPVC
PLGQCKVSVIPPIALNSTDSDGFCRATFSFCVSPLLVFVNSKSGDNQGVKFLRRFKQLLN
PAQVFDLMNGGPHLGLRLFQKFDNFRILVCGGDGSVGWVLSEIDKLNLNKQCQLGVLPLG
TGNDLARVLGWGGSYDDDTQLPQILEKLERASTKMLDRWSIMTYELKLPPKASLLPEPPE
ASEEFYMTIYEDSVAAHLTKILNSDEHAVIISSAKILCETVKDFVAKVEKSYEKTLENTV
AADAMASKCSVLNEKLEQLLQALHTDSQATPIVPGIRSVIVEEDTVESSSEESLCESKEQ
LVDDPTKPPSQKAVKPKEIMLRANSLKKAVRQVIEEAGKVMDDQTVHPCEPVNQSFDNDS
TETDESKEESKDDDAKESLTVKTAPAPRSPDGRTTRFQTDSGPGPAVAAGKENLPVLNTR
IICPGLRAGLAASIAGSSIINKMLLANIDPFGATPFIDPDPDSVDGYSEKCVMNNYFGIG
LDAKISLEFNNKREEHPEKCRSRTKNLMWYGVLGTRELLQRSYKNLEQRVQLECDGQYIP
LPSLQGIAVLNIPSYAGGTNFWGGTKEDDIFAAPSFDDKILEVVAIFDSMQMAVSRVIKL
QHHRIAQCRTVKITIFGDEGVPVQVDGEAWVQPPGIIKIVHKNRAQMLTRDRAFESTLKS
WEDKQKCDSGKPVLRTHLYIQHAVDLATEEVSQMQLCSQAAEELITRICDAATIHCLLEQ
ELAHAVNACSHALNKANPRFPESLTRDTATEIAINVKALYNETESLLVGRVPLQLESPHE
ERVSNALHSVEVELQKLTEIPWLYYILHPNEDEEPPMDCTKRNSRSTVFRIVPKFKKEKV
QKQKTSSQPVQKWGTEEVAAWLDLLNLGEYKEIFIRHDIRGAELLHLERRDLKDLGITKV
GHMKRILQGIKEFGRSTPQSEV
Download sequence
Identical sequences F1PFD9
ENSCAFP00000007060 ENSCAFP00000007060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]