SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000007093 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000007093
Domain Number 1 Region: 542-643
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-23
Family Pleckstrin-homology domain (PH domain) 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000007093
Domain Number - Region: 222-327,542-562
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0502
Family BAR domain 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000007093   Gene: ENSCAFG00000004757   Transcript: ENSCAFT00000007658
Sequence length 648
Comment pep:known_by_projection chromosome:CanFam3.1:1:111608375:111629757:1 gene:ENSCAFG00000004757 transcript:ENSCAFT00000007658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTPSGPEEGGQPPPVSEGDAEARPQGAAQPHVHPEDPHEPEAPAAPEEPQPVKELPSGR
GAEQQAEEEEEVGEGSSTESSRDAGEAPPPARTPATPPASSPPGEGVRGAARRLREQQLE
ALTRVALMEQRVKELQRQRKELRIEMEVEVALLRGELAGERVAARREEEQLRELLGQQVD
TEQGSHEQREQEQRQLIQERDRVEGLRQRLQEAQGQLDSQPEDQRERLLQGVQEMREQLD
AAQRAYEDLEFQQLEQESRREEEDQDSPGARAGDPKVRELQASVAQHRRRIQVLEEQLKS
LGEQMAAESRGLSQKKEEALQALTQERNRLLELNCLQRTPGRNFSESSQALTKLLITQKT
DRQLLVYQDPTAHTASTTSSCLFSVHSSLQGSIGLQRTGSLPRKRGERASQRGSPRPLSL
HCTGPLGASALPPASGDSGRHPLYQLLNCGPGNSCGSLHPDIARMEQLLQQAVAERERLL
KAREGLRRSKEGSSGPAVPALMAPPSPPPRPPGPRVLDLRQHLERWGHSPESCPHVRVSG
GCCRGSLVKMGGRIKTWKKRWFCFDRQARRLAYYADKEETKLKGVIYFQAIEEVYYDHLR
CAFKSPNPRLTFCVKTYERLFYMVAPSPEAMRIWMDVVVTAADENHAP
Download sequence
Identical sequences E2RFK8
ENSCAFP00000007093 ENSCAFP00000007093 XP_005616554.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]