SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000007147 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000007147
Domain Number 1 Region: 7-264
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.24e-61
Family Ankyrin repeat 0.0000421
Further Details:      
 
Domain Number 2 Region: 553-622
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.96e-18
Family SAM (sterile alpha motif) domain 0.0069
Further Details:      
 
Domain Number 3 Region: 484-549
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.55e-16
Family SAM (sterile alpha motif) domain 0.0043
Further Details:      
 
Domain Number 4 Region: 267-346
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000144
Family SH3-domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000007147   Gene: ENSCAFG00000004787   Transcript: ENSCAFT00000007714
Sequence length 1202
Comment pep:known_by_projection chromosome:CanFam3.1:9:5017492:5033845:1 gene:ENSCAFG00000004787 transcript:ENSCAFT00000007714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGREQDLILAVKNGDVTGVQKLVAKVKAAKTKLLGSTKRLNVNYQDADGFSALHHAALGG
SLELIALLLEAQATVDIKDSNGMRPLHYAAWQGRLEPVRLLLRASAAVNAASLDGQIPLH
LAAQYGHYEVSEMLLQHQSNPCLVNKAKKTPLDLACEFGRLKVAQLLLNSHLCVALLEGE
AKDPCDPNYTTPLHLAAKNGHREVIRQLLRAGIEINRQTKTGTALHEAALYGKTEVVRLL
LEGGVDVNIRNTYNQTALDIVNQFTTSQASREIKQLLREASGILKVRALKDFWNLHDPTA
LNVRAGDVITVLEQHPDGRWKGHIHESQRGTDRVGYFPPGIVEVVSKRVGVLAPRLPSAP
TPLRPGFSRTPQPPADDPLHPLTYGQLPRVGLSPDSPAGDRNSVGSEGSVGSIRSAGSGQ
SSEGTNGHGTGLLIENAQPLPSMGEDQVLPGLHALPLADNLNHRPLVHYRSGEQLFTQDV
RPEQLLEGKDAQAIHNWLSEFQLEGYTAHFLQAGYDVPTISRMTPEDLTAIGVTKPGHRK
KIASEIAQLSIAEWLPNYIPADLREWLCALGLPQYHKQLVSSGYDSMGLVADLTWEELQE
IGVNKLGHQKKLMLGVKRLAELRRGLLQGEVPVEGGGRRLARGPELMAIEGLENGDGPAA
TGPRLLTFQGSELSPELQAAMAGGGPEPLPLPPARSPSQESIGARSRGSGHSQEQPAPQP
SGGDSSTPQERNLPEGTERPSKLCSPPPGQGPPPYVFMHPQASPSSPAPGPPPGAPRAFS
YLAGPPATPPDPPRPKRRSHSLSRPGPAEGEAEGEAEGPADSALGSYATLTRRPGRSALA
RTSPSPTPARGAPRSQSFALRARRKGPPPPPPKRLSSVSGPTTEAPSLDGSPGPKEGASG
PRRRTLSEPTGPSEPPSPPVPAGPVSDTEEEEPGPEGTPPSRGSSGEGLPFAEEGNLTIK
QRPKPAGPPPREAPVPAGLDFNLTESDTVKRRPKCREREPLQTALLAFGVASATPSPSAP
LPSQTPSEPSSAAPSPPRLDPSSLPTQGAPAPLSPSPQTQPSAPPCPGPALESSTGDWRH
GETEPPASPAALIKVPGAGTAPKPVSVACTQLAFSGPKLAPRLGPRPVPPPRPESTGAVG
SGRAQQRLEQTSSSLAAALRAAEKSIGAEEREGPPSTSAKHILDDISTMFDALADQLDAM
LD
Download sequence
Identical sequences E2RAV0
ENSCAFP00000007147 XP_005624157.1.84170 XP_005624159.1.84170 XP_005624161.1.84170 XP_540433.1.84170 ENSCAFP00000007147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]