SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000007400 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000007400
Domain Number 1 Region: 323-554
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-58
Family DBL homology domain (DH-domain) 0.000000654
Further Details:      
 
Domain Number 2 Region: 1-160
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 9.42e-55
Family Regulator of G-protein signaling, RGS 0.000000119
Further Details:      
 
Domain Number 3 Region: 557-690
Classification Level Classification E-value
Superfamily PH domain-like 1.64e-37
Family Pleckstrin-homology domain (PH domain) 0.0000258
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000007400   Gene: ENSCAFG00000028799   Transcript: ENSCAFT00000007993
Sequence length 855
Comment pep:known scaffold:CanFam3.1:JH373987.1:1801:12513:1 gene:ENSCAFG00000028799 transcript:ENSCAFT00000007993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQLCCLHADMLSSLGPKEAKKAFLDFCHCFLDKTAVLRVLVPPAVAFELDRTRPEVISED
LQRQFVQEVVQSQQAAVSRLLEDFRSKRLMGMTPWEQDLTQLEAWVGRDRASFEARERHL
AERLLAHLEEMQHTISNDEEKSAAVVNAISLYMRHLGVRTKSGDKKSGMNFFRKKVMGNR
RSDEPTKTKKGLSIFLDPARWNRGEPQASDFRHLKVETDAEKPGLTERKGGLGVPSRDRN
VGAPGQDVPGVSLHPLPGDSPDREPGVDTPPELGDPPPQGPASLEPPGPSESTEEGPDTE
SPEPGDEGDPGRSGLELEPEEPPGWRELIPPGTLHSLPKSQVKRQEVISGGPTELLVTEA
AHVRMLRVLHDLFYQPMLEGNFFSTEDLQNIFPSLDELIEVHSLFLDRLMKRRQDSGCLI
EEIGDVLLARFDGAEGKWFQKISSRFCSRQSFALEQLKAKQRKDPRFCAFVQEAESRPRC
RRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEESAEREKVELAAECCREILHHVNQAVRDM
EDLLRLKDYQKRLDLSLLRQSSDPMLSEFKNLDITKKKLIYEGPLTWRLTKDKAVEVHVL
LLDDLLLLLQRQDDRLLLKSHSRTLTPTPDGKTMLRPVLRLTSAITREVATDHKAFYVLF
TWDQEAQIYELVAQTVSERKNWCSLITETAGSLKVPAPASRPKPRPSPSSTREPLLSSSE
NGNGGGREMPPADGQTERILSTLLPYCRPRPEGQLAAKALEKVLSLKQLLFPSEEDSGAG
PPQEGDGVPGGGPLNPTQTHTQEIREKLLSLEETMKQLEEVEEEFCHLRLLLSQLGENST
PHLSASQGSTSQSLS
Download sequence
Identical sequences H9GW85
ENSCAFP00000007400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]